KEGG   Raphanus sativus (radish): 108811644Help
Entry
108811644         CDS       T06014                                 

Definition
(RefSeq) uncharacterized protein LOC108811644
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00790  Folate biosynthesis
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    108811644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsz04147]
    108811644
Enzymes [BR:rsz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     108811644
Exosome [BR:rsz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108811644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 108811644
NCBI-ProteinID: XP_018439233
Position
Unknown
AA seq 186 aa AA seqDB search
MSRLLLPTLFSISRKQVLAASSFHNLYGRRHRSFVYWTSAAMSQDSAIGDSASGAKTFCS
SLQDLSAKKCVPCNAKDLHPMTEQSAQELLQKVAGWDMANDNGTLKLHRSWTVKSFTKGL
DFFKRVADIAESEGHHPDLHLVGWNNVKIDIWTHAIGGLTENDFILAAKINELQVEDLLR
KKKVAK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagtcggctcttgctgcctacgcttttctcaatctctagaaaacaggttctagctgcg
tcatccttccacaatctgtacggacgacgtcacaggagctttgtttattggacgagcgct
gctatgtcgcaagatagtgcaattggtgactctgcttctggagctaaaacattctgctcc
tccctacaagatttatcagcaaaaaagtgtgtcccatgcaacgctaaggatctacacccc
atgactgaacaaagtgcccaagaactacttcagaaggttgctggatgggatatggctaat
gacaatggcacattaaagctgcatcgatcgtggacagtgaaaagttttacaaaaggacta
gacttcttcaaacgtgtagctgatatcgctgaatcagaaggtcatcacccagatttgcat
ctggtaggctggaataatgtgaagatcgacatatggacacatgccataggtggtttgacc
gagaacgacttcattctagctgctaagatcaacgagctccaagtggaagatcttctgagg
aagaagaaagttgccaaatga

DBGET integrated database retrieval system