KEGG   Raphanus sativus (radish): 108812096Help
Entry
108812096         CDS       T06014                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz03040  Spliceosome
rsz04141  Protein processing in endoplasmic reticulum
rsz04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108812096
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108812096
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108812096
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rsz01009]
    108812096
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rsz03041]
    108812096
   03009 Ribosome biogenesis [BR:rsz03009]
    108812096
   03110 Chaperones and folding catalysts [BR:rsz03110]
    108812096
   04131 Membrane trafficking [BR:rsz04131]
    108812096
   03051 Proteasome [BR:rsz03051]
    108812096
   03029 Mitochondrial biogenesis [BR:rsz03029]
    108812096
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsz04147]
    108812096
Protein phosphatases and associated proteins [BR:rsz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108812096
Spliceosome [BR:rsz03041]
 Complex B
  Other components
   Prp19 complex
    108812096
 Complex C
   Prp19-CDC5 complex
    108812096
Ribosome biogenesis [BR:rsz03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108812096
Chaperones and folding catalysts [BR:rsz03110]
 Heat shock proteins
  HSP70 / DNAK
   108812096
Membrane trafficking [BR:rsz04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108812096
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108812096
Proteasome [BR:rsz03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108812096
Mitochondrial biogenesis [BR:rsz03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108812096
Exosome [BR:rsz04147]
 Exosomal proteins
  Proteins found in most exosomes
   108812096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 108812096
NCBI-ProteinID: XP_018439758
Position
Unknown
AA seq 651 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDSERLIGDAAKN
QVAMNPTNTVFDAKRLIGRRFSDPSVQADMRHWPFKVVSGPAEKPMIVVNHKGEEKQFSA
EEISSMVLTKMREIAEAFLGTPIKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEP
TAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKHKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
TTITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSNVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQIFSTYSDNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKK
KVDAKNALENYAYNMRNTIKDEKIASKLDAADKKKIEDAIDQAIEWLEGNQLAEADEFED
KMKELESLCNPIIARMYQGGAGADMGGAGGMDDDAPAGGSGGAGPKIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtaaaggcgaaggtccagcgatcggaatcgatctcggcacaacctactcctgc
gtcggcgtctggcagcacgaccgcgtcgagatcatcgccaacgatcaaggcaaccgcacc
actccttcctacgtcgccttcaccgacagcgagcgtctcatcggtgacgcggccaagaat
caagtcgctatgaaccctaccaacaccgtcttcgatgcgaagcgtctcatcggaagaaga
ttcagcgatccctccgtacaggcggacatgaggcactggcctttcaaagtcgtctccggc
ccagccgaaaagcccatgatcgtcgtcaaccacaagggagaggagaaacagttctcagcc
gaagagatctcctcgatggtcctcaccaagatgcgcgagatcgcggaagccttcctcgga
acaccgataaaaaacgccgtcgtaacggtccccgcttatttcaacgactcccagcgtcaa
gcgactaaagacgccggagtcatctcgggactcaacgtgatgcgtatcatcaacgaacct
accgcagccgccatcgcgtacggtctcgacaagaaggcctctagcgtcggcgagaagaac
gtgctgatattcgatctgggaggagggacgttcgatgtctctctgcttacgatcgaggaa
gggatctttgaagtgaaggctactgctggtgatactcatctcggtggggaggattttgat
aacaggatggtgaatcacttcgttcaggagttcaagaggaagcataagaaggatatcaca
gggaatccgagggcgttgaggaggttgaggacggcttgtgaacgggcgaaaaggactctc
tcttcgaccgcgcagacgacgattgagatcgattctttatacgaagggattgacttctac
acgacgatcacgcgcgcgaggttcgaggagctgaacatggatttgttcaggaagtgtatg
gaacccgtggagaagtgtttgagagacgcgaagatggataagagcaatgttcatgacgtt
gtgcttgttggggggtccactaggatccctaaggtccagcagctgttgcaggattttttt
aatgggaaggagctttgtaagagtattaacccggacgaggctgttgcttatggagcggcg
gttcaggcggcgattctgagtggggaagggaatgagaaggttcaggatttgttgcttctt
gatgttacgcctttgtccttggggttggagactgctggtggtgtgatgactgttttgatt
ccgaggaacacaacgattccgacgaagaaagagcagatcttctcgacttattcggataac
cagcccggtgttttgatccaagtttacgaaggagagagagcaaggacgaaagataacaac
cttttggggaagtttgagcttagcggcatccctcctgcacctcgaggtgttccgcagatc
actgtgtgttttgacatcgacgccaacggtatcttgaacgtgtcggctgaggacaagacg
actggtcagaagaacaagattaccattactaatgacaagggaaggctgtcgaaggaagag
atcgagaagatggtacaagaagcagagaagtacaaagcagaggatgaagaacacaagaag
aaggtggatgcgaagaatgctttggagaactatgcgtacaacatgaggaacacgatcaag
gatgagaagatcgcgtcaaagcttgatgcagctgacaagaagaagatcgaggatgcaatc
gaccaggctattgagtggttggagggtaatcagctggcggaggcggatgagttcgaggac
aaaatgaaggagctcgagtctctttgcaacccaatcattgcgagaatgtaccaaggcggc
gctggtgctgacatgggtggcgctggtggcatggacgatgatgcacctgccggtggtagt
ggcggtgctggacctaagattgaagaagtcgattaa

DBGET integrated database retrieval system