KEGG   Raphanus sativus (radish): 108813078Help
Entry
108813078         CDS       T06014                                 

Definition
(RefSeq) insulin-degrading enzyme-like 1, peroxisomal
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rsz01002]
    108813078
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     108813078
Peptidases and inhibitors [BR:rsz01002]
 Metallo peptidases
  Family M16: pitrilysin family
   108813078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16_C Peptidase_M16 CSS-motif
Motif
Other DBs
NCBI-GeneID: 108813078
NCBI-ProteinID: XP_018441016
Position
Unknown
AA seq 970 aa AA seqDB search
MAVEKLSTTVDGAEILKPRTDNREYRKIVLKNSLQVLLISDPDTDKCAASMSVSIGSFSD
PQGLEGLAHFLEHMLFYASEKYPQEDSYSKYITEHGGSTNAYTSSEETNYHFDINADCFS
EALDRFAQFFIKPLMSADATMREIKAVDSENQKNLLSDGWRMRQLQKHLSKEDHPFHKFS
TGNMDTLHVKPQAKGVDTTSELIKFYKEHYSANIMHLVVYGKESLDKIQDLVEGMFQEVQ
NTNKTIPRFPGQPCTSDHLQILVKAVPIKQGHKLNVSWPVTPSIHRYEEAPCRYLGHLIG
HEGEGSLFHALKTLGWATGLGAGEGDWTLDYSFFTVSIDLTDAGHEHMQDILGLLFKYIQ
LLQQTGVCQWIFDELAAICETKFHYQDKTPPMSYIVDIASNMQIFPTRDWLVGLSLPSKF
NPATIQKVVDELSPSNARILWESQKFEGQTDKNEPWYNTAYSLEKISSSTIQEWVKSAPD
VNLHLPAPNVFIPTDLSLKDAKDKETVPVMLRNSPFSRLWYKPDTMFSKPKAYFKMDFNC
PLAVSSPDAAVLTDIFTRLLMDYLNEYAYYAQVAGLHYGVSLSDNGFELTLLGYNHKLRI
LLETVIEKIANFEVKPDRFAVIKETVTKEYQNYKYRQPYHQAMYYCSLILQDQTWPWTEE
LEVLSHLEAEDVAKFVPMLLSRTFIECYIAGNVEGNEAESMVKHVEDVLFNDPKPKCRPL
FPSQHLTNRVVKLEEGMKYFYHQDGSNPSDENSALVHYIQVHRDDFAMNIKLQLFGLVAK
QATFHQLRTVEQLGYITALAQRNDSGIYGVQFIIQSSVKGPGHIDSRVESLLKNFESKLR
EMSDEEFKSNVTALIDMKLEKYKNLKEESRFYWQEIQRGTLKFNRKEAEVTALRQLQKQE
LVDFFEEYIKIGAARKKSLSIRVYGSQHLNEMASDKNEVPSPCVEIEDIVGFRKSQPLHG
SFRGCGQPKL
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgagaaattgagcacgacggtggacggcgccgagatactgaagccacgtacg
gacaacagagaatacaggaagattgtcctcaagaactccctccaagtcctgttgatcagc
gatcccgacaccgataagtgtgctgcttcaatgagcgttagtatcggatctttctctgac
ccacaagggctagaaggcttagctcacttccttgagcatatgctattctatgcaagtgag
aaatatccacaggaagatagttactccaagtacatcactgagcatggagggagcacaaac
gcgtatacatcctctgaagagacaaactaccatttcgatattaatgctgattgtttcagt
gaggctttggacaggtttgctcagttctttatcaaaccgctaatgtcagctgatgccacc
atgagggagattaaggctgttgactcagagaatcagaaaaacttactctctgatggttgg
cgaatgagacagttacagaagcatctaagcaaagaagaccatccctttcacaaatttagc
acaggaaacatggatacacttcatgtaaaaccccaagcgaaaggagttgatacaacgagt
gagcttattaagttctataaagaacactactctgccaacatcatgcacctcgttgtatat
gggaaggaaagccttgacaagattcaagatcttgtggaagggatgttccaggaagtccaa
aacaccaacaaaactatccctagattccctggtcagccatgcacttcggaccatttgcag
attcttgtgaaggctgttcctataaagcaaggacacaagctcaacgtttcgtggcccgta
actcctagcattcatcgttacgaagaagcaccatgccggtaccttggccatctaattgga
catgaaggcgaaggaagtttgtttcatgccttgaaaactttgggttgggcaacgggactt
ggtgctggagaaggagattggactcttgattattctttcttcaccgtttcgattgacctt
accgatgctggtcatgagcacatgcaagatatattggggttgctgttcaaatacattcag
ctattacaacagactggtgtctgtcagtggatttttgatgagctcgcagctatttgcgag
acaaaatttcattatcaagacaaaacaccaccaatgtcttatatagtggatattgcatca
aacatgcagatatttccgactagggactggttggttggattgtcactgccttctaaattt
aatccagccactatacaaaaggttgtagatgagctttctcctagtaatgctcgaatcctt
tgggagtcacagaagtttgaaggacaaacggacaagaatgagccatggtataacactgca
tattctcttgagaagataagcagctctaccattcaggagtgggtgaagtctgctcctgat
gtaaacctgcatctaccagcgcctaatgtcttcattcctacagatttgtcactaaaggat
gctaaggataaggagactgtcccagttatgttgagaaactcgcctttctcgagactgtgg
tacaagccagatacgatgttctcgaaaccaaaggcatatttcaagatggatttcaattgt
cctctcgctgtcagctctccggacgcagcagttcttacagatatcttcacgagattgttg
atggactatttaaatgaatatgcttattatgcacaagttgctggtcttcactatggtgtg
agcctttcagacaatggtttcgagttgacccttcttggttacaatcacaagttaaggatt
ttgctggaaactgttattgaaaagatagccaattttgaagttaaacctgacaggtttgct
gttatcaaggaaactgtgacaaaagagtatcaaaactacaaataccgacagccatatcac
caagcaatgtattattgctcgctgatattacaagatcaaacctggccttggacagaggaa
ctagaagttctttctcatttggaagctgaagatgtagctaagtttgtcccaatgttgtta
tcaaggacatttattgagtgttatatagcaggtaatgtggagggcaacgaagccgagtcg
atggttaagcatgttgaagacgttctttttaatgatccaaagcctaagtgccgaccgttg
ttcccatcccagcaccttactaatagagttgtgaagctcgaagaaggaatgaagtatttc
taccaccaagatggctcgaaccccagtgatgaaaactctgctctagtacactatattcag
gttcacagagatgactttgccatgaatattaagcttcagctatttggtctcgttgcaaag
caagccacctttcaccaacttagaacggtggagcaacttggttacatcactgcacttgct
cagaggaacgattctggcatttatggtgtacagttcattatccagtcatcagtgaagggt
cctggacatattgattcgagggtggagtctttactgaaaaactttgagagtaaactccgt
gagatgagtgatgaggaattcaagagcaatgtaacagctttgatagacatgaagcttgaa
aaatacaagaacctgaaggaagagtcccggttttactggcaagagattcaaaggggaaca
ctcaaattcaaccgtaaagaggcagaggttactgcactgaggcagcttcagaagcaagag
ttggtagatttcttcgaggagtacatcaagattggagcagcaaggaagaagtcgctgagc
ataagagtgtatgggagccagcatttgaatgaaatggcaagtgacaaaaatgaagtccca
tcaccatgtgttgaaatcgaagatattgttggtttcagaaagtcccagcctcttcacggg
tcgttcagaggatgcggacaacccaaactgtga

DBGET integrated database retrieval system