KEGG   Raphanus sativus (radish): 108814778Help
Entry
108814778         CDS       T06014                                 

Definition
(RefSeq) flavonoid 3'-monooxygenase
  KO
K05280  flavonoid 3'-monooxygenase [EC:1.14.14.82]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00941  Flavonoid biosynthesis
rsz00944  Flavone and flavonol biosynthesis
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    108814778
   00944 Flavone and flavonol biosynthesis
    108814778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rsz00199]
    108814778
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.82  flavonoid 3'-monooxygenase
     108814778
Cytochrome P450 [BR:rsz00199]
 Cytochrome P450, plant type
  CYP75 family
   108814778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 ScsC_N
Motif
Other DBs
NCBI-GeneID: 108814778
NCBI-ProteinID: XP_018442906
Position
Unknown
AA seq 511 aa AA seqDB search
MTNLFLTILLPTFIFLIVLVLSRRRNNRLPPGPNPWPIIGNLPHMGPKPHQTLAAMVTTY
GPILHLRLGFADVVVAASKSVAEQFLKVHDANFASRPPNSGAKHMAYNYQDLVFAPYGQR
WRMLRKISSVHLFSAKALEDFKHVRQEEVGTLMRELARANTKPVNLGQLVNMCVLNALGR
EMIGRRLFGAGADHKAEEFRSMVTEMMALAGVFNIGDFVPALDCLDLQGVAGKMKRLHKR
FDAFLSSILEEHEMMKNGQDQKHTDMLSTLISLKGTDFDGDGGTLTDTEIKALLLNMFTA
GTDTSASTVDWAIAELIRHPEIMTKAQQELDSVVGRGRPINESDLSQLHYLQAVIKENFR
LHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWTDPLSFRPERFLPGGE
KAGVDVKGNDFELIPFGAGRRICAGLSLGLRTIQLLTATLVHGFEWELAGGITPEKLNME
ETYGITLQRAVPLVVHPKPRLDMSAYGLGSV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgactaatctcttcctcacaatccttctccctactttcatcttccttattgtcctcgtc
ttatctcgccgccgcaacaaccgtctccctcccggtccaaacccatggcccatcatcggg
aacctccctcacatgggccctaaaccccatcaaacactagccgccatggtaaccacatac
ggccctatcctccacctacggctagggttcgccgacgttgtggttgccgcctctaaatcc
gtggccgaacagttcttgaaagttcacgatgccaattttgctagccgaccacctaactcc
ggagccaaacacatggcatacaattatcaagatcttgtctttgcgccttatggacaacga
tggagaatgttgaggaagattagttctgttcatttattttcagctaaagctctggaagat
tttaaacatgttcgacaggaagaggttggaacactcatgcgcgagctagcgcgtgcaaac
acgaaaccagtgaacctaggccagttggtgaacatgtgcgtactcaacgcccttggacga
gagatgatcggacggcggctgttcggcgccggagccgatcacaaagcggaggagtttcga
tcaatggtcacagaaatgatggctctcgccggagtgttcaacatcggagatttcgtgccc
gcacttgattgtttagacttacaaggcgtcgctggtaaaatgaaacgtctccacaagagg
ttcgacgcttttctatcgtcgattttggaagagcacgagatgatgaagaacggtcaggat
caaaagcacacggacatgcttagcactttaatctcgcttaaggggactgattttgacggt
gacggtggaacactaacggatactgagatcaaagccttgctattgaacatgtttactgct
ggaactgacacgtcagcaagtacggtggactgggccatagctgaactgatccgtcacccg
gagataatgacaaaagcccaacaagagcttgattccgtcgtcggacgtggaaggcccatt
aacgagtcagacctctctcagcttcattaccttcaggcggttatcaaagagaattttaga
ctccatccaccaacaccactctcgttaccacacatcgcatcagagagctgtgagatcaac
ggctatcatatccccaaaggatcaacccttttgacaaacatatgggccatagcccgtgac
cctgaccaatggaccgacccgttatcgtttcgacccgagagattcttacccggtggtgaa
aaagcgggcgtcgatgtgaaaggaaacgacttcgagctcataccgttcggagcagggagg
agaatctgcgccgggctgagtttagggttacggacgattcagttactgacggcgacgctt
gtgcacggatttgaatgggaactggccggaggaattacgccggagaagctgaacatggag
gagacttatgggatcactctgcaaagagcggttcctttggttgttcatcctaagccgagg
ttggatatgagtgcttacgggcttgggtctgtttaa

DBGET integrated database retrieval system