KEGG   Raphanus sativus (radish): 108818004Help
Entry
108818004         CDS       T06014                                 

Definition
(RefSeq) glutathione S-transferase U10-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00480  Glutathione metabolism
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108818004
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsz02000]
    108818004
Enzymes [BR:rsz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108818004
Transporters [BR:rsz02000]
 Other transporters
  Pores ion channels [TC:1]
   108818004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_N_4
Motif
Other DBs
NCBI-GeneID: 108818004
NCBI-ProteinID: XP_018446350
Position
Unknown
AA seq 235 aa AA seqDB search
MEGMEEKKSKVILHGMWASTYSKRVEIALKLKGISYEYVEEDLKNKTESLIQLNPVHKKI
PLLVHDGKPVAEPLVILDYIDETWKNSPPFYPEDPYERAQVRFWVSYINQQVFEVMGRVM
LQEGEAQTKSVKEARERFEVLEDGLKKHFPNKTIRGNDDVGLLDIIIIASFGVHKAIHEA
IGVETIDPLNTPTLYNWIERLQQLPVIKEVQVPHDRLVTFLQKYRQEHLQQAAKA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaagggatggaggaaaagaagagcaaagtgatattacatgggatgtgggcaagcaca
tactccaagagggtcgagatcgccctgaaactcaagggtatatcctacgagtacgttgaa
gaagatctaaagaacaagaccgagtctctgattcaactcaaccctgttcacaagaagatt
cctctccttgtccatgatggtaaaccagtggctgaaccactagtgattcttgactatatc
gatgaaacgtggaagaactctcctcctttctacccagaggatccttatgaaagggcccag
gttcggttctgggtcagctacatcaaccagcaggtgtttgaggtcatgggtcgagtaatg
ttacaagagggtgaagctcaaacaaagtctgtgaaagaggctagagaaaggttcgaagtt
cttgaagatggactcaagaagcacttcccgaataaaaccatcagagggaatgatgacgta
gggcttttggacatcatcatcatcgctagttttggagtccacaaagctattcatgaagcc
atcggtgtagagacaattgatccactgaacactccgactttatacaactggatagagcgc
ctgcaacagctgcctgtgatcaaagaagtccaagtgccacatgataggttggtgaccttt
cttcagaagtatagacaagagcatctccagcaggctgcaaaggcgtaa

DBGET integrated database retrieval system