KEGG   Raphanus sativus (radish): 108818170Help
Entry
108818170         CDS       T06014                                 

Definition
(RefSeq) mannose-1-phosphate guanyltransferase alpha-like
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00051  Fructose and mannose metabolism
rsz00520  Amino sugar and nucleotide sugar metabolism
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Module
rsz_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    108818170
   00520 Amino sugar and nucleotide sugar metabolism
    108818170
Enzymes [BR:rsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     108818170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 108818170
NCBI-ProteinID: XP_018446568
Position
Unknown
AA seq 415 aa AA seqDB search
MGSSMDEKVVAVIMVGGPTKGTRFRPLSLNIPKPLFPIAGQPMVHHPISACKRIPNLAQI
YLVGFYEEREFALYVSAISNELKVPVRYLREDKPHGSAGGLYHFRNLIMEDNPSHIFLLN
CDVCCSFPLPEMLEAHRKYGGIGTLLVIKVSPESASQFGELVADPVTNELLHYTEKPETF
VSDRINCGVYVFTPDIFTAIRDVSSQRKDTASLRRVSSVEALQPATRNSTDFVRLDQDIL
SPLAGKKQLYTYETMDFWEQIKSPGMSLKCSGLYLSQFRLTSPQVLASGDGTKSAIVNGD
VFIHPSAKVHPTAKIGPNVSISANARVGPGVRLISCIILDDVEIMENAVVTNAIVGWKSS
IGRWSRVQAEGVYHSKLGVTILGDSVAVEDEVVVTSSIVLPNKTLNVSVQDEIIL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggggagctcaatggatgagaaagtggtggctgtgatcatggtcggtggtccaaccaaa
ggtactcgattccgaccattgtccctgaatattccaaagcctctgtttcctattgctgga
cagccaatggtgcatcacccaatttcagcttgtaaaaggattccaaacttagctcaaatc
tatctcgttggtttctatgaggaaagagagtttgcactttacgtctctgccatttccaat
gaactcaaagttcctgtcagatatctgcgagaagacaagccacatggttcagctggtggt
ctgtatcactttagaaatctaatcatggaagataacccgtctcatatcttcctgcttaac
tgtgatgtttgctgcagtttccccttgcctgaaatgctcgaggctcatcggaaatatggt
ggaattggaactcttcttgtaatcaaggtttcgcctgaatcagcaagtcaatttggagaa
ctggttgcagatccagttactaacgagctgcttcattacaccgagaaacctgaaactttt
gtcagtgaccgcattaactgcggagtttatgtatttacacctgacatttttactgccata
agagacgtttcctctcaaaggaaagatacagcatctctgagacgtgtttccagcgtcgaa
gctcttcaaccagcaacaaggaactccacggattttgtaagactggatcaagacatcctt
tcacctctggctgggaagaaacagctatatacttacgagactatggatttctgggagcaa
attaaatctcctggaatgtcgctgaagtgctcgggactctatctttcccagttccggttg
acctcacctcaagtgttggctagtggtgatggaacaaagagtgccatagtgaacggtgat
gttttcatacatccttctgccaaagtacacccaactgcaaagattggtcccaacgtctca
atctctgccaatgctcgtgttggacccggtgtcaggcttattagctgtatcatccttgat
gacgttgagatcatggaaaatgcagtggtgactaatgcaattgttgggtggaaatcttct
atcgggagatggtcccgtgtccaggctgagggagtctaccactccaaactcggagttaca
attctgggagactcggttgcagttgaagacgaagttgtggtgaccagcagtattgttctt
ccaaacaagacgctcaacgtcagcgttcaagacgagatcatcttgtaa

DBGET integrated database retrieval system