KEGG   Raphanus sativus (radish): 108818263Help
Entry
108818263         CDS       T06014                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, cytoplasmic-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00030  Pentose phosphate pathway
rsz00480  Glutathione metabolism
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01200  Carbon metabolism
Module
rsz_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rsz_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    108818263
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108818263
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rsz04147]
    108818263
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     108818263
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     108818263
Exosome [BR:rsz04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   108818263
  Exosomal proteins of colorectal cancer cells
   108818263
  Exosomal proteins of bladder cancer cells
   108818263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 108818263
NCBI-ProteinID: XP_018446673
Position
Unknown
AA seq 512 aa AA seqDB search
MGSGGWHVEKRSTLRNDSFVKEYGSAPETGCLSIVVLGASGDLAKKKTFPALFNLYRQGF
LNPDEVHIFGYARTNLSDEQLRDRIRGYLVDEKNADALSKFLLLIKYVSGPYDSEEGFQR
LDRAISEHEISKNSSQGSSRRLFYLALPPSVYPSVCKMIKTCCMNKSDLGGWTRIVVEKP
FGKDLESAEQLSSQIGELFDESQIYRIDHYLGKELVQNMLVLRFANRFFLPLWNRDNIEN
VQIVFREDFGTDGRGGYFDEYGIIRDIIQNHLLQVLCLVAMEKPISLKPEHIRDEKVKVL
QSVVPITDEEVVLGQYEGYRDDPTVPDDSNTPTFATTILRIHNERWEGVPFILKAGKALN
SRKAEIRIQFKDVPGDIFRCQKQGRNEFVIRLQPSEAMYMKLTVKQPGLEMQTVQSELDL
SYGQRYQGVSIPEAYERLILDTIKGDQQHFVRRDELKVAWEIFTPLLHRIDKGEVKSIPY
KPGSRGPKEADQLLEKAGYLQTHGYIWIPPTL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggatctggtgggtggcacgttgagaagaggtcaactctaaggaatgattcgtttgtt
aaggagtacggttcagctccagagactggttgtctttccatcgtcgtccttggcgcatca
ggtgatcttgccaagaagaagacttttcctgcccttttcaacctataccgccagggattt
ctcaatccagatgaagttcacatctttgggtatgccaggactaatctttctgatgaacag
cttcgagatcggatccgtggataccttgttgatgagaagaacgcagatgccttgtcaaag
tttctactgctgatcaagtatgtgagtggcccttatgactcagaggaagggttccagaga
ttagacagggctatttccgagcacgaaatctccaaaaatagctctcaaggatcctcgagg
agactcttttacctagcacttccaccctctgtttatccttctgtatgcaagatgatcaag
acatgctgcatgaacaaatctgaccttggtggatggacacggattgttgttgagaagcca
tttggaaaggacctggaatctgcagagcaactcagttctcagattggagagttgtttgat
gaatcgcagatctatcgtattgatcattatcttggcaaagaattggtccaaaacatgttg
gtcctccgatttgccaatcgctttttcctgccactttggaaccgtgacaatatcgagaac
gtgcagattgttttcagggaagattttggaactgacgggcggggcggatattttgatgaa
tacggaatcatccgtgatattattcaaaaccatctgctccaggttctttgtcttgttgcc
atggagaaaccgatatctcttaaacccgagcacatccgcgatgagaaagtgaaggtgctt
caatcagtggttccaataaccgatgaagaggtggttcttggacaatatgaagggtatagg
gatgatcctactgttccagacgactcaaacactccaacgtttgccacaacaattcttcgc
atacacaacgaaagatgggaaggtgttccatttatcctgaaggcgggaaaggcgctaaat
tcaaggaaggcagaaattagaattcagttcaaggatgttccaggcgacatattcagatgt
cagaaacaagggaggaacgagtttgtgatacgcctgcaaccatcagaggcaatgtacatg
aaactaactgttaagcaaccgggtctcgagatgcaaaccgtgcaaagtgaactagacttg
tcatacggacaacgttatcaaggtgtctccatcccggaggcatacgagcgcttaattctt
gacacaattaaaggtgatcaacagcatttcgttcgcagagacgaactaaaggttgcgtgg
gagatctttacaccgttgctgcacaggattgacaaaggagaagtgaagtcaatcccatac
aaaccaggaagccgaggaccaaaagaagctgatcagttactggagaaagcgggttacctt
caaactcatggctacatctggatccctcctacattataa

DBGET integrated database retrieval system