KEGG   Raphanus sativus (radish): 108820327Help
Entry
108820327         CDS       T06014                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At5g16900 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsz01001]
    108820327
Enzymes [BR:rsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108820327
Protein kinases [BR:rsz01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108820327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr LRR_4 LRR_8 LRR_1 TadF ABC1 DUF4519
Motif
Other DBs
NCBI-GeneID: 108820327
NCBI-ProteinID: XP_018448787
Position
Unknown
AA seq 472 aa AA seqDB search
MSTSPGIISLRNLSSQGLTGKIVPHIQNLTQLQILDLSNNKLTRGVPEFLANMKSLLFIN
LSNNNLEGSIPRALLDRDKLKLYFEGNPKICALDPCKSSGGNKKIKTIVPVATAVAIFLV
VFVVIVVFIKKRPSSIRAVQSARTNLSLEGKMRRISYSEIQLMTNNFERVIGEGGFGVVY
HAYLDDRQQVAVKVLSRSSSQGYKQFKAEVELLLRVHHTNLVALVGYCDEQPHLALIYEY
MSNGDLKAHLSGKYGECVLNWANRLRIAVETALGLEYLHSGCKPPMVHRDVKSVNILLDE
HLQAKLADFGLSRSFSIGDETHVSTGVVGTPGYLDPEYYKTRRLTEKSDVYSFGIVLLEI
ITNQPVIEQANEYAHIAERVGNMLTRGDIKTTVDPDLHDEYDSGSVWKALELAMSCVHPS
PVARPDMSHVVHELKECMKAENLRAGLSQVTESKSSLDQDMSSDSGMAPNAR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctacttcacccgggatcatttctcttagaaacttatcttcacaaggattaactgga
aaaatagtgccgcatatccaaaatctaacacagctgcaaatattggacttgtcaaataac
aagttgaccagaggtgtgccagaattcctagccaacatgaagtcactattgttcataaac
ttaagcaataataatcttgaaggttccattccacgagctcttcttgacagagacaagctg
aaattatattttgaaggaaatccaaagatttgtgcattagatccatgcaaaagttcaggc
ggaaataaaaaaatcaaaaccatagtacccgttgcaactgccgtggctatttttttagtt
gtttttgttgtcattgttgtattcataaagaaaaggccatcaagtataagagctgtacaa
tcggcacggactaatctgtcgcttgaaggtaaaatgagaaggatatcatactctgagata
caattgatgacaaataacttcgaaagggttattggtgaaggagggtttggagttgtctat
catgcttatttggatgatagacaacaagtggctgttaaagtgctctcccgctcatcatct
caaggctataagcaattcaaagcagaggttgagcttcttcttagggttcaccacacaaat
ttggtagcccttgtaggatattgtgatgaacagccacacttggccctcatctacgagtac
atgtctaacggagacttaaaagcacatctttcagggaagtatggggagtgtgttttaaac
tgggcaaacagattaagaatagccgtggagactgcactaggactggagtacctgcacagc
ggatgcaaaccaccaatggttcacagagatgttaaaagcgtgaacatattgttagatgaa
catcttcaagctaagctagctgatttcggtctttctagatctttttctattggagatgaa
actcatgtgtccactggtgttgttggcactccaggatacttagatcctgaatattacaaa
acacgtcgcttgaccgagaagagtgatgtctatagttttgggattgtgctattggagatc
atcacaaatcaaccagtgattgagcaagccaatgagtacgctcatatcgctgaacgtgta
ggaaatatgctgacaaggggagatattaaaaccacagtggatcccgacctccatgacgag
tatgattctggctctgtgtggaaagctcttgaactcgccatgtcgtgtgtgcatccttct
ccggttgcaagaccggacatgtctcatgtcgttcatgaacttaaagagtgcatgaaggct
gaaaatttgagggcgggattaagccaagtcacggagtcaaagagttctttggatcaagac
atgagttctgattcggggatggctccgaacgcacggtag

DBGET integrated database retrieval system