KEGG   Raphanus sativus (radish): 108820584Help
Entry
108820584         CDS       T06014                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
Organism
rsz  Raphanus sativus (radish)
Brite
Enzymes [BR:rsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108820584
Protein kinases [BR:rsz01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108820584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind EGF_CA cEGF EGF_3 FXa_inhibition Haspin_kinase PIP49_C
Motif
Other DBs
NCBI-GeneID: 108820584
NCBI-ProteinID: XP_018449054
Position
Unknown
AA seq 732 aa AA seqDB search
MKVHGVFLVAVFFYLGYTELVKGQPRNDCQTSCGKVTIEYPFGTSPGCYYADDRSFNLTC
NEKEELLFGNIEVINISPSGELRVWKKVSYACYNSTGYLTNGSDHTTTLGNLSLSRKNEF
TIVGCNAYAYLTTTGPQNYSTGCISACDSPPAANGGCNGAGCCSTDVSAPLGSWKYRTRP
FRLGSSTSVYDFNPCTYAFLTENGTFHFNASEDLKNLRNVNKFPLVLDWSIGNQTCEQVG
NRSICGTNNSICFNSTRGTGYNCKCLEGYEGNPYLSNEHGCQDINECTINKHNCADPRTC
RNTVGGFYCKCRSGYRLDTTTMSCKRKDFAWATILLGITIGFLSLLLVVSYVQQRLKHRK
AAELRQKFFEQNGGGMLVQRLSGPGISNANVKIFTEEGMKTSTDGYDKSRILGQGGQGTV
YKGILPDNSIVAIKKARLGDNSQVEQFINEVLVLSQINHRNVVKLLGCCLETEVPLLVYE
FINSGTLFDHLHGSLFGPSLTWEQRLRIAVEIAGTLAYLHSSASIPIIHRDVKTANILLD
ENLTAKVADFGASRLIPMDKEQLTTMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMEL
LSSQKALCFERPLQSKHLVNYISSAMKENRLHEVIDEKLINENNWKEIEEAVRVAMECTR
VTGEERPLMTEVAAKLEGLRVTKSKHQWSDQYPGEETENLVGVGILSAQGDTSSTGYDSI
KNVASMHMEAGR
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcatggtgtgttcttggtggcggttttcttctaccttgggtatacagagctg
gtcaaggggcaacctcgcaatgactgccaaactagttgtggaaaagtcacaattgagtat
ccttttggcacttctccaggttgttactatgcagacgatcgtagtttcaatctcacctgt
aatgagaaagaggagctattatttggtaacattgaagtaatcaacatatctcccagcggg
gagctacgcgtctggaaaaaagtttcctacgcttgctacaatagcacaggatatttgact
aacggcagtgaccacacaaccacgctgggtaatttatctctctcccgcaagaacgagttt
actatagtaggctgtaacgcttacgcatatctgaccactactggaccccaaaattactca
actggatgcatctcagcatgtgactctccacctgcggcaaatggagggtgtaatggtgca
ggttgctgcagtacagacgtctctgcgccgttgggtagctggaaatacagaactcgccca
tttcgtttggggagcagcacttcggtgtatgactttaatccttgcacatacgcctttctc
acggaaaatggtacttttcacttcaatgcttcggaagatcttaagaacctacggaatgtc
aacaagtttcccctggtactggactggtctattggaaaccagacatgcgagcaagttgga
aacagaagcatatgcggtacgaataacagcatatgtttcaattctactcgtggaaccggg
tataactgcaaatgtttagaaggttatgaagggaatccttacctttctaatgaacacggt
tgccaagacatcaatgagtgtactatcaataaacataactgtgcggatcccaggacctgt
agaaacacggtaggaggcttctattgtaagtgccgatctggttatcgcttagatacaacc
actatgagttgcaagcgtaaagactttgcatgggctaccattcttcttggaataaccatc
ggcttcttgtccctattgcttgtcgttagctatgtacaacagagactgaagcaccggaag
gcagctgagctccgacaaaaattcttcgaacaaaatggtggcggcatgttagtacagaga
ctctcaggaccagggatatcaaatgctaatgtaaaaatctttactgaagaaggcatgaag
acatcaaccgatggttatgacaagagcagaatcctgggccagggaggacaaggaaccgtc
tacaaagggatattaccagacaactccatagtcgcaataaagaaagctcggcttggagac
aacagccaagtagagcagttcatcaacgaagtgctagttctttcacagatcaaccatagg
aacgtggtcaagctcttgggctgctgtctagagactgaagttcccttgcttgtctatgag
ttcattaacagcggcactcttttcgatcacttgcacggttctttgtttggtccttctctt
acatgggaacaacgcctgaggatagcagtggagatagctggaacccttgcttatcttcac
tcctctgcttctattccaatcatccaccgagacgtcaagacggctaacattctcttggat
gaaaacttaactgcaaaggtagccgactttggtgcttcaaggctgataccgatggataaa
gagcagctcacaacaatggtgcaaggcactctaggctacttagatccggaatactacaac
actggtctgctgaacgaaaagagtgatgtttatagctttggtgtagttctcatggaactt
ctctcaagccaaaaggcattgtgcttcgaaaggccactccagtcaaaacatctggtgaat
tacatttcttctgccatgaaggagaacaggttgcacgaggttattgacgagaaattgatc
aacgagaataactggaaggagatagaggaagctgtcagagttgctatggagtgcacaaga
gtgacgggagaagaaaggccactgatgacggaagtagctgcaaagcttgagggcttgaga
gtcacgaaaagcaaacatcagtggtcagatcagtatcctggggaggagactgagaacttg
gtcggtgttggaatcttatcagcgcaaggcgatacaagtagcactggctatgacagcatc
aagaatgtagcaagcatgcacatggaagctggtcgctga

DBGET integrated database retrieval system