KEGG   Raphanus sativus (radish): 108825648Help
Entry
108825648         CDS       T06014                                 

Definition
(RefSeq) erlin-1-like
  KO
K23341  erlin
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rsz04121]
    108825648
Ubiquitin system [BR:rsz04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    108825648
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 108825648
NCBI-ProteinID: XP_018454479
Position
Unknown
AA seq 358 aa AA seqDB search
MDPQQRRTETGPRPPVGQPGGDVTSIFVVFGIFIAIAALVMSPSSLVHQVPEGHVGAYWR
GGALLNSITEPGFHLKLPFITNYEPVQVTLQTDQVKDIPCGTKGGVMITFEKIEVVNRLR
KDYVYDTLLNYGVDYDNTWIYDKIHHEINQFCSSHSLQQVYIDIFDQIDERMKDALQADC
TRYAPGIEIISVRVTKPKIPESVRRNFEQMEEERTKVLIAIEKQRVAEKEAETKKIMAIS
EAEKNANVSKILMEQKLTEKDSARREADIENQMYLDRQKSLADADYYRVLKEAEANKLKL
TPEFLELKFIDAIARNTKMFFGDKVPNMVLDQRLLGNFLSQSVEDQSNDGNLETATDS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatcctcaacagcggagaactgaaacaggtccgcgtcctccggttggacaacccggc
ggcgacgtgacttcgattttcgtcgtgttcggtattttcatcgctatcgccgctttggtc
atgtccccttcatcgttggtccaccaagtccctgaaggacacgttggagcgtattggaga
ggtggtgctcttctcaacagcattacagagcctggttttcatttgaagctgcctttcatt
accaactacgagcctgttcaagttactctccaaactgatcaagtgaaggatataccatgt
ggtaccaaaggaggtgtcatgattacctttgaaaagattgaagttgttaatcgtctgcgt
aaggattatgtctatgacactttgctcaactacggtgtcgactatgataacacatggatt
tacgacaagattcaccacgagatcaaccagttctgcagctctcattcccttcagcaagtc
tacattgacatctttgaccagattgacgagcgaatgaaagatgctcttcaggctgattgc
acacgttatgctccaggaatcgagatcattagtgtgcgtgtcactaagcctaaaattcca
gagagtgtaaggcgcaactttgagcagatggaagaagaacgcactaaggtcttgattgct
attgagaaacaaagagttgctgagaaagaggcagagacaaagaagataatggccattagt
gaagccgagaagaatgccaatgttagtaagattctgatggagcagaagctgactgagaaa
gacagtgcacggagagaagctgacatcgagaatcagatgtatcttgatcgtcaaaagagt
cttgccgatgcagattactaccgtgtactgaaagaagctgaagcaaacaagttgaagctc
actcctgaatttctcgaacttaagttcatcgatgccattgcacgtaacaccaaaatgttc
tttggggacaaggtacctaacatggtgttggatcaaaggctgcttgggaacttcctcagt
caatcggtagaagaccaatctaatgatggaaacttggaaacggccactgattcgtag

DBGET integrated database retrieval system