KEGG   Raphanus sativus (radish): 108828376Help
Entry
108828376         CDS       T06014                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 2 isoform X1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00564  Glycerophospholipid metabolism
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108828376
Enzymes [BR:rsz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     108828376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase EF-hand_5 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 C2 Dockerin_1
Motif
Other DBs
NCBI-GeneID: 108828376
NCBI-ProteinID: XP_018457544
Position
Unknown
AA seq 646 aa AA seqDB search
MHIEVTRDATFRSNVEEFVGELREEDEEIDKRSNGKRKLEGGEGITTVKAKAEATERAVT
VDDFSGIALLTLIGADMKFKDKWLACVSFGEQTFRTEISDTTEKPIWNSEKKLLLEKNGP
SLARVSVFETNRLSRNKIVGYCELDIFDFVVQEPESACKSFDLLDPASSNVVGTVFLSCA
IEDPVETEKRFAKRILSVVDYNEDGQLSFSEFSDLIRAFGNLVAANKKEELFRAADLNGD
GVVSIDELAALLALQQEKEPIINSCPVCGESLQPTDKLNAMIHMTLCFDEGTGNQVMTGG
FLTDRQASYGWMFKLSEWTHLSTYDVGLNTGSSASHIVVIDRKTKRLVEELIDSKIVLSM
RAIYQSKIGLRLMDQGAKEILQKLSEKQGKKMNSVESAQKIPSFLEFFKDQINMAEVKYP
LQHFKTFNEFFIRELKPGARPIAHMNRDDVAVCAADCRLMAFQSVEDSTRFWIKGRKFSI
RGLLGKDVNPNAFLDGSLVIFRLAPQDYHRFHVPVSGVIEKFVDVSGSLYTVNPIAVNSK
YCNVFTENKRTVAIISTSEFGKVAFVAIGATMVGSISFVRKEGDHLKKGDELGYFSFGGS
TVICVFEKNSIRLDEELLANSGRSLETLVSVGMQLGVSTRTFTGSP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcatatagaggttactagggacgccacgtttcggtcaaacgtagaagaattcgtagga
gaattgagagaggaagacgaagagatcgacaagaggagcaatgggaaacggaaactcgag
ggaggggaaggaatcacgacggtcaaggctaaagcagaagctacagagagagctgtcacc
gtcgacgatttctccggcattgcccttctcactctcataggcgcggacatgaagtttaag
gacaagtggctcgcttgtgtttcgttcggggaacagacattcagaacagagatctcagac
actacggagaagccaatctggaactcagaaaagaagcttctcttggagaaaaatggacca
agtctcgctagggtctctgtattcgagacaaataggctgtcgaggaacaaaatagtcggt
tattgcgagcttgatatattcgattttgtggtccaggaacctgagtcagcttgtaagtca
tttgacttgttagatcctgcttcatccaatgttgttggcaccgttttcctttcgtgcgct
attgaggatcctgttgaaaccgagaagcggtttgcaaagcgtatcttgtcagtagtggac
tacaatgaagatggacaactctccttctcagagttctctgatctaatacgtgccttcgga
aacttagtggctgctaacaagaaagaggagctgttcagagctgccgacctgaacggtgat
ggtgttgtgagcattgatgagttagctgcgcttcttgctctgcaacaagagaaggagcca
attataaatagttgtcccgtgtgtggtgaatctcttcaacccactgacaagctcaatgcg
atgatacatatgacgctatgttttgacgaaggaacgggtaatcaagtgatgactggtggg
tttttgactgatagacaagcttcttatggatggatgttcaaactaagtgaatggacacac
ttatctacttatgacgttggtttgaatactggttcaagtgcttctcatattgtggtgatt
gacaggaagactaagagacttgttgaagagttgatcgactcaaagattgttctgtccatg
agagctatttaccagtccaaaatcgggcttagacttatggatcaaggggcaaaggagata
ctgcaaaaactttctgagaagcaggggaagaaaatgaactcagttgaatccgctcaaaaa
attcccagctttctcgagttctttaaggatcaaataaacatggctgaagtcaagtatcct
ctacaacacttcaagacgttcaatgagtttttcataagggagttgaaacctggtgcaaga
ccaattgctcacatgaatcgtgatgatgttgctgtatgtgctgctgattgtcgattaatg
gcattccagtcagttgaggatagcaccagattctggatcaagggccggaagttttcgatt
agaggtctccttgggaaggatgtgaatccaaatgcctttcttgatggatctttggtgata
ttccgactagcaccacaggattatcatcgctttcatgttcctgtctctggagtcattgaa
aagtttgttgatgtgtctggaagcttatatacggttaatccaatagcagtcaatagcaaa
tactgtaacgtattcacggagaataaacgaaccgtggcaattatatcaacgtcagagttt
ggaaaggttgcttttgttgcaatcggtgcaactatggttggtagcatcagttttgtcaga
aaagaaggggaccatctgaaaaaaggagacgaacttggttatttttcgtttggtggaagc
accgttatatgcgtctttgaaaagaactccatccggctcgatgaggaactcttagctaac
agtggtaggtcattagagacattagttagtgttggtatgcaactaggtgtctccacaagg
acatttactggttctccatga

DBGET integrated database retrieval system