KEGG   Raphanus sativus (radish): 108830160Help
Entry
108830160         CDS       T06014                                 

Definition
(RefSeq) biotin--protein ligase 2-like
  KO
K01942  biotin---protein ligase [EC:6.3.4.9 6.3.4.10 6.3.4.11 6.3.4.15]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00780  Biotin metabolism
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    108830160
Enzymes [BR:rsz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.9  biotin---[methylmalonyl-CoA-carboxytransferase] ligase
     108830160
    6.3.4.10  biotin---[propionyl-CoA-carboxylase (ATP-hydrolysing)] ligase
     108830160
    6.3.4.11  biotin---[methylcrotonoyl-CoA-carboxylase] ligase
     108830160
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     108830160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB BPL_C BPL_LplA_LipB_2 DUF366
Motif
Other DBs
NCBI-GeneID: 108830160
NCBI-ProteinID: XP_018459265
Position
Unknown
AA seq 358 aa AA seqDB search
MQVANLSRFISLRPLRPLYFSVAAAAMDGNDSCSLVLCGKSSVENDTAKRLKNANVLKLP
DDSPKVSLFLASEIKNLVRVDDDDSFNLSVFMNLLSTSRFGRFLIWSPRLSSTHDLVSHN
FSELPVGSVCVSDIQFKGRGRTKNVWESPKGCLMYSFTLEMEDGRIVPLIQYVVSLAVTE
AVKDVCDNKGLPYIDVKIKWPNDLYLNGLKLGGILCTSTYRSRKFHVSVGVGLNVDNDQP
TTCLNAVLKEISPAASILLKREEIIAAFFHKFEKFFDLFLDQGFKSLEELYYRTWLHSGQ
RVIVEDKIEDQVVQNVVTIQGLTSSGYLLAIGDDYQMYELHPDGNSFDFFKGLVRRKI
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtggcgaacttgtcgcgtttcatctctttaaggcctttgcgtcctctttatttc
tccgtagctgccgcagcaatggatggtaatgattcgtgtagcttggttttgtgcgggaag
tcctctgttgagaacgatacagcaaagcgtttgaagaacgccaacgtgcttaagctccca
gatgattctcctaaagtttcactctttttagcttccgagattaagaatcttgttagagtt
gatgatgatgattcattcaatctttcagtcttcatgaacttgctttcaacttctcggttc
ggtcggtttctcatttggtctccccgcttgtcttccactcacgatcttgtttctcataac
ttttctgagcttccggttggttcagtttgtgtctcagacattcagtttaagggtagaggc
agaacaaagaatgtctgggaatccccaaagggctgtctgatgtattcctttacgttagaa
atggaagatggtcgaatcgtgcctttgattcaatatgttgtttctcttgctgtaaccgag
gcagtgaaagatgtttgtgacaacaagggtttgccgtatatagatgttaaaataaagtgg
cctaatgatctttacttgaatggccttaaactcgggggcattttgtgtacctctacctac
agatctagaaaatttcacgttagtgttggtgtgggattgaatgtggacaacgatcaaccc
accacatgcttaaacgctgtactaaaagagatatctcctgctgcatcaattctacttaaa
agagaagaaattattgctgccttctttcataaattcgagaaattctttgatcttttcttg
gaccaaggttttaaatctctagaggagctttactacaggacatggcttcacagcgggcaa
agagtgattgttgaagataaaatcgaggaccaagttgttcaaaacgttgtgactatccag
ggtttgacatcttcgggatatctgctggctattggagatgattatcaaatgtatgagctt
caccctgatggcaatagttttgactttttcaaaggtctagtccgaagaaaaatatga

DBGET integrated database retrieval system