KEGG   Raphanus sativus (radish): 108837228Help
Entry
108837228         CDS       T06014                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00010  Glycolysis / Gluconeogenesis
rsz00053  Ascorbate and aldarate metabolism
rsz00071  Fatty acid degradation
rsz00280  Valine, leucine and isoleucine degradation
rsz00310  Lysine degradation
rsz00330  Arginine and proline metabolism
rsz00340  Histidine metabolism
rsz00380  Tryptophan metabolism
rsz00410  beta-Alanine metabolism
rsz00561  Glycerolipid metabolism
rsz00620  Pyruvate metabolism
rsz00903  Limonene and pinene degradation
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108837228
   00053 Ascorbate and aldarate metabolism
    108837228
   00620 Pyruvate metabolism
    108837228
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108837228
   00561 Glycerolipid metabolism
    108837228
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108837228
   00310 Lysine degradation
    108837228
   00330 Arginine and proline metabolism
    108837228
   00340 Histidine metabolism
    108837228
   00380 Tryptophan metabolism
    108837228
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108837228
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    108837228
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     108837228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 BMC DtxR
Motif
Other DBs
NCBI-GeneID: 108837228
NCBI-ProteinID: XP_018465793
Position
Unknown
AA seq 536 aa AA seqDB search
MASRRVSSLLSRSFMSSSPSLFALRGKDPVMMNRGAHRYSNHAEDTITPPVKVEHTQLLI
NGKFVDAASGKTFPTLDPRSGEVIAQVAEGDVEDVNRAVSAARKAFDEGPWPRMTAYERS
KILLRFADLVDKHNDEIAALETWDNGKPFEQSAKVEVPMLARVFRYYAGWADKIHGMTVP
GDGSHHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVG
RLLYEAGLPEGVVNIVSGFGPTAGSAIASHMDIDKVAFTGSTGVGKIILELASKSNLKAV
TLELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKAR
AIKRAVGDPFKSGIEQGPQVDSEQFKKILKFIKHGVENGATLQAGGDRFGSKGYYIQPTV
FSDVKDDMLIATDEIFGPVQTILKFKNLDEVIARANNSRYGLAAGVFTQNLDTANRLMRA
LRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLNNYLQVKAVVTAIKNPAWL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaagagtatcttcactgctctctcgctccttcatgtcctcctcgccttct
cttttcgctcttagaggcaaggaccctgtcatgatgaacagaggagcgcacagatacagc
aaccacgctgaagacacgatcactccgcctgtgaaagtggagcacacacagctcttaatc
aacggaaagttcgttgatgccgcctcaggaaagacgttccccactttggatccaagaagt
ggagaagtaatcgctcaggtggctgaaggtgatgtggaagacgtgaaccgtgccgtttca
gctgcacgcaaggcctttgatgagggtccatggcctagaatgactgcttatgagagatca
aagatactacttcgtttcgctgacttggtcgacaaacacaacgacgagattgctgctctt
gagacttgggacaatgggaagccttttgaacagtctgccaaggttgaagtccctatgctc
gccagggtgtttcgttactatgctggttgggcagacaagatccatggtatgacggttcca
ggagatggttcacaccatgtgcagacactccatgagcctattggagtcgctggacagatc
atcccttggaacttccctcttctcatgctttcttggaagcttggaccagctttggcttgt
ggtaacactgttgttctcaagacggctgagcaaactcctctctctgctcttcttgttgga
agattactttacgaggctggacttcccgagggagttgtcaatatagtttctggatttggt
cctacagctggttcagccatagctagtcacatggacattgacaaggttgctttcaccggt
tctactggtgttggaaaaattattcttgagttggcttcaaaaagcaaccttaaggcagtg
actcttgagcttggaggcaagtcaccattcattgtatgtgaggatgctgatgtggatcag
gcagttgagcttgctcatttcgctttgttctttaaccagggacaatgctgctgtgctggc
tcccgaacatttgtgcatgaacgagtgtatgatgagtttgtagagaaagctaaagctcgc
gcaatcaaacgcgctgttggcgatcccttcaagtctggcattgagcagggtccccaggtg
gactcagagcagttcaagaaaatcttgaagttcattaaacatggagttgagaatggagcc
accttacaagctggaggtgaccggtttggttccaagggctactacattcaacccactgtc
ttctcagacgtcaaagacgacatgctcatagcaacggacgagatcttcggacctgttcaa
accatcctgaaattcaagaatctggatgaggtgattgccagggctaacaactcaaggtac
ggtttagctgcaggagtgttcactcagaatctggacacagcgaatcggctgatgagagcg
ctcagggtcggaagcgtttggataaactgtttcgatgtgtttgatgccacaattccattt
ggagggtataagatgagtggcattggaagagagaaaggtatctacagtctcaacaattac
ttgcaagtcaaagctgttgtcactgccatcaagaaccccgcttggctctaa

DBGET integrated database retrieval system