KEGG   Raphanus sativus (radish): 108844943Help
Entry
108844943         CDS       T06014                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rsz01001]
    108844943
   01009 Protein phosphatases and associated proteins [BR:rsz01009]
    108844943
Enzymes [BR:rsz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108844943
Protein kinases [BR:rsz01001]
 Serine/threonine kinases: Other
  Wnk family
   108844943
Protein phosphatases and associated proteins [BR:rsz01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108844943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 108844943
NCBI-ProteinID: XP_018473727
Position
Unknown
AA seq 552 aa AA seqDB search
MNVNQVSEYVETDPTGRYGRFAEVLGRGSMKTVYKAIDEMLGIEVAWSQVQLKEVLRSSV
DIQRLYSEVHLLSTLNHKSIIRFYTSWIDVRSHTLNFITELFTSGTLRQYKNKYLRIDIR
AIKSWARQILEGLVYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLARMLQDCRSAH
SILGTPEFMAPELYEENYNELIDVYSFGMCFLEMITSEFPYSECNNPAQIYKKVVAGKLP
GAFYRVRDIEAQRFISKCLVPASKRVSARELLQDPFLASEESWMVYARGAENLKPFLNEN
EMDRLKLEDDELGIGRSHMTITGKLNAEDNNTIFLNVIIADEDGKAKKVSFPFDIMNDTS
IDVAKEMVKELEITDWEPVEIAKMIDGEISSLVPGWRYEEEDNENPHFNSSSSHSSSSQA
SLSSYKAQGRQDWLQGSFSHVNYIYVDEHSPQPPAMNRTHNVTRFCPEESSRLHSGHANM
YGTSSSSNWRLASDNRALTRNRSLVDVQRKLLQRSLVEEARKRRLIKTVGDVENVGFQSP
YAVSRKPQISRR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaaatcaagtttcagagtatgtcgaaaccgatcccactggacgctacggacgt
tttgcagaagttcttggaaggggatcgatgaagacagtgtacaaagcaatcgacgagatg
ctgggaatagaagtagcgtggagccaggttcagctaaaagaggttctccgttcctctgtt
gatatacagaggctctactcggaggttcatcttctcagcactctaaaccacaaatccatc
attcgtttctacacttcctggatcgatgtccgttcccacactctcaacttcatcaccgag
ttgttcacttctgggaccctccgacaatacaaaaacaagtacttgcggatagatatcaga
gcaatcaagtcatgggctcggcagatcttggaagggcttgtttatctccacgggcacgac
cctcctgttatccacagagacctcaagtgtgacaatatctttgttaatggacatcttgga
caagtcaaaattggcgatcttggtcttgcaagaatgctgcaagactgccgctctgcccat
agtatcctcggcactcccgagttcatggctccagagttatatgaagaaaactataatgag
ctcattgacgtttattcctttggtatgtgttttctggagatgatcacttctgagttcccg
tatagtgaatgcaacaatccggcgcagatttacaagaaagttgttgcgggaaagctgcca
ggagccttttacagagttagagacattgaggcacagaggttcatcagtaaatgcctcgtg
cctgcctcaaagagagtctcagcaagagaactattgcaagatccatttctagcgtctgaa
gagtcctggatggtgtacgcgagaggagctgagaatctgaagcccttcttgaacgagaat
gaaatggacagacttaagttggaagatgatgagttaggaataggaaggagccatatgacc
atcactgggaagctgaacgctgaagataacaacacaatcttcctgaacgtaataatcgca
gatgaagatggtaaggctaagaaagtttctttcccctttgacatcatgaatgatacttcc
attgatgttgcaaaggagatggtgaaagaactcgagatcacagattgggagccagtcgag
attgctaaaatgattgatggagagatctcttctttggtgcctggttggaggtacgaggag
gaagataatgaaaaccctcatttcaactcttcttcctcgcattcatcatcctctcaagct
tcactctctagctacaaggcacaaggccgtcaagattggctacaagggtccttttcccac
gtcaactacatttatgttgatgagcacagccctcaacctcctgctatgaacaggacccac
aacgtgacgaggttctgccccgaagaaagctctcgtctacattcaggacacgccaacatg
tatggaacttccagttcgagtaactggagactggcatcagacaaccgcgcacttacgagg
aaccgctcacttgtagacgtgcagaggaagttactgcaacggtctctggtggaagaggct
aggaagagaaggttgatcaaaaccgttggagatgtagaaaacgttgggtttcagtcacct
tatgcggtttcccggaagccacagatctcaaggcgctag

DBGET integrated database retrieval system