KEGG   Raphanus sativus (radish): 108846796Help
Entry
108846796         CDS       T06014                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4-like
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
rsz  Raphanus sativus (radish)
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rsz03016]
    108846796
Enzymes [BR:rsz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     108846796
Transfer RNA biogenesis [BR:rsz03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    108846796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_4 Kelch_1 Kelch_5 Kelch_6 Kelch_3 Kelch_2 MTS DNA_methylase Cons_hypoth95 Methyltransf_15 Methyltransf_25 Fibrillarin_2
Motif
Other DBs
NCBI-GeneID: 108846796
NCBI-ProteinID: XP_018475501
Position
Unknown
AA seq 994 aa AA seqDB search
MEFEKRKAATLASIRSSVTDKSPKGYLDEPILPLLETINHHPSFFTTSSCSGRISILSQP
KPQSTTTTTTKKKARGGSWLYITHDPADPESVLNLLFPPNPPTQITDSSELVFRFEPLII
AVECKDVSSAQFLVATAISAGFRESGITCCGEGKRVIIAIRCSIRMEVPLGDTETVLVSR
EYVRFLVGVANEKMVANRKRTDGFGLALLSNGFKSPGDGNDVDEEDNFENLAGTQESRSI
NNGDLHPGLHQDLMPLSTISITGEPVEKLHLWGHSACTINKTDRREVIVFGGFGGFGRHA
RRNESMLLDPSCGTLKLVTVNESPSPRLGHTASMVGDLMFVIGGRADPLNILNDIWMLDI
SKCEWSSQRCIGCEFPPRHRHAAASIGSNIYVFGGLNQEKILSSLHLLDTKNLQWKEIEQ
RGQWPCARHSHDMVAYESQLFMFGGYNGEKVLDDLYSFDVQSSSWKLEVVSGKWPQARFS
HSMFVYKHVIGIIGGCPVSQNCHDLVLLDLKHRLWRSVRLDFMNKELLVRSTASVIGDDL
IVIGGGAACYAFGTKFSEPVKINLLQSLTMSENHVTPQHEDASIEVKTEASLCQPCVLQL
ERKYAKFGKDILKNFGWLDLERKVYSHEKGLYICFPVTKKFSELFHEKQLLDKDLEGSED
NHLTSQLTKGLSLKEISSSVALNLLKELGARKFTTVAVEAKKVAKSPLQRMKEAVTSILK
QKGLPEELLDELPQKWERLGDIVVLPVTSFKDPAWSSISEEVWSAVAVSLSANRLARQGR
VEANGTRDSTLEILVGDDGWVDHRENGILYSFNATKCMFSWGNLSEKLRMGNMACENEVV
VDLFAGIGYFTLPFLVRAKATMVYACEWNPHAIEALRHNVEANFVSDRCMVLEGDNRITA
PKGVADRVCLGLIPSSEGSWVTAIQALRPEGGILHVHGNVKDTDVTSWAEHVSKSLSDIA
RAEGRRWEVTVEHIEKVKWYAPRIRHLVADVRCS
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggaattcgagaagaggaaagccgcgacgctagcctcaatccggtcatcggtaacggac
aaatctccaaaaggctacctggacgagcccatcctccctctcctcgaaaccatcaaccac
cacccttccttcttcaccaccagctcctgctccggccgtatctcaatcctctcccaaccc
aaaccacaatcaacaactacaacaacaaccaagaagaaagctcgcggcggctcgtggctc
tacatcactcacgatccagcagatccggagtcggtactcaacctcctcttccctcccaac
ccgccgactcagattactgattccagcgagctggtcttcagattcgagcctttgatcatc
gcggtggagtgcaaggacgtgagctcggctcagtttctcgtggcgacggcgatctcagcg
gggtttagagagtcggggatcacgtgctgcggggagggtaaaagggtaattatagctata
cggtgttcgattcggatggaggtgccgttgggcgatacggagacggtgttggtttcgagg
gagtatgtgaggtttcttgtcggtgttgcgaatgagaagatggttgctaataggaagcgg
actgatgggtttggtttggctttgttaagtaacggtttcaaaagtccaggtgatggtaat
gatgtagacgaggaggataatttcgagaatctagctggaactcaggagtcaagaagtatc
aacaatggtgacttgcatcctgggcttcatcaagatcttatgccgctctcaacaatatcc
atcaccggggaacctgtcgagaagcttcacctctggggacattcagcttgtactataaat
aaaacagacagaagagaagttatcgtgtttggtggctttggcggttttggtagacatgcc
agaagaaacgagtctatgttgctcgacccttcatgcggcaccttaaagttggtcacagtc
aatgaatctccatcaccacggcttggacatacagcttcaatggttggcgatctcatgttt
gttattggaggaagagctgatcccttgaatattctgaatgatatttggatgcttgatata
tcaaagtgtgagtggagctcacagagatgcattggatgtgaatttcctccgaggcatcgt
catgcagcagccagtattggctcaaatatatacgtattcgggggacttaaccaggagaag
atattatcctcgttgcaccttttggacaccaagaaccttcagtggaaagaaattgaacag
agaggtcaatggccttgtgcacgccactctcatgatatggttgcatatgagtctcagcta
ttcatgtttggaggatacaatggtgagaaggtacttgatgatctatacagctttgacgtg
caaagctcttcttggaaacttgaagtggtttcagggaaatggcctcaggccaggttttcg
cactccatgtttgtgtataaacatgttattggcataattggaggttgccctgtttcgcaa
aactgtcatgatttagttctgctagatctgaagcaccgattgtggaggagtgtgagactg
gactttatgaacaaagagctattagttcgaagtacagctagtgtgattggcgatgatctt
atcgttattgggggtggggctgcttgctatgcttttgggacaaagtttagtgaaccagtg
aagatcaacttgcttcaatcattgactatgagcgaaaatcatgtcactcctcaacacgaa
gatgcttctatagaagtgaagactgaagcttctctgtgtcagccctgtgtcttacagtta
gaaagaaagtatgcaaagtttggcaaggacatacttaaaaactttggatggttagacctt
gagaggaaagtttactcacacgaaaaaggtctttatatctgcttccccgtgactaagaag
ttctctgagcttttccatgaaaagcagcttttggacaaggatttagaagggtcagaagat
aatcaccttaccagtcagctcacaaagggtctatcgctgaaggaaatatccagctctgtg
gctttgaatctattgaaggagcttggtgctagaaaattcactactgtagctgttgaagcc
aaaaaagtagcaaagtctcctttacaaagaatgaaagaagctgtcacgtctatacttaaa
cagaaaggtctaccagaggagcttttggatgagcttccacagaaatgggaacggcttgga
gatattgtcgtactacctgtaacatcttttaaagatccagcttggagctctataagtgag
gaagtttggtctgctgttgctgtatcgcttagtgccaaccgtcttgcacgccaaggacgt
gtggaagccaacggtacaagggatagtacattggagattcttgtgggagacgatggatgg
gtggatcatcgtgaaaatggaatcttgtactcttttaatgctaccaagtgtatgttctca
tggggcaatctctcggaaaagctgcgtatgggtaacatggcctgcgaaaatgaagttgtg
gtggacctgttcgctggaattggatactttaccctccctttccttgtgagggcaaaggca
acgatggtatatgcttgtgaatggaatcctcatgccattgaagcacttcgacataacgtt
gaagcaaattttgtttctgaccgttgtatggttcttgaaggagataaccggatcactgca
cctaaaggagtagctgacagagtctgtcttggtcttatcccatctagcgaaggaagctgg
gtcacagctatccaggcgttaaggcccgagggaggaatactccatgtgcatggaaacgtc
aaggacacggatgtgacaagttgggccgagcatgtctccaaatcattaagtgatatcgcc
agagccgaaggtcgtaggtgggaagttacagtagaacatatagagaaagtgaaatggtat
gctcctcggattcgccatcttgtagctgatgttagatgcagctga

DBGET integrated database retrieval system