KEGG   Raphanus sativus (radish): 108847026Help
Entry
108847026         CDS       T06014                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108847026
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rsz03041]
    108847026
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108847026
Spliceosome [BR:rsz03041]
 Complex C
  Other components
   Step II factors
    108847026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD zf-RING_UBOX zf-C3HC4_2 AAA_22 zf-C3HC4 Helicase_RecD zf-RING_2 AAA_19 AAA_30 Secretin_N AAA_29 ABC_tran
Motif
Other DBs
NCBI-GeneID: 108847026
NCBI-ProteinID: XP_018475697
Position
Unknown
AA seq 1767 aa AA seqDB search
MSSSLPPADGGRSATNRHSSFPSASTNRRNFLSPPLNHRHTHHNHHQYPNSSFPPNHRRD
RPPSPPNFVVQLLHPRISPASAGSGDAAKPSFSVRKQVISTLASLIGIPEDSIHVPQFGC
VAGSFRFRQWVDALSAVVSLWEYRLQGKTLLVPELVANVTVPSDVDELRDRLRALFSAHV
TSLLDNGDCVKKVRAEIEEKSRQVESFSSKRGLKLEAFEKKKALEAERDLIVKRLEEFKN
GMKSIVRFLEGSVPDGEKDDVAVFSLEGAYDWPRIHSLIRRECRRLEDGLPIYAYRRNIL
KRIHGEQVMVLIGETGSGKSTQLVQFLADSGVAASESIVCTQPRKIAALTLADRVREESN
GCYEENSVRCTPAFSSTEEISSKVVFMTDNCLLQHYIKDRSLSGVSCVIIDEAHERSLNT
DLLLALLKDLMCRRIDLRLVIMSATADAYQLSDYFFGCGILCVTGRNFPVEIIYSPSDAE
GTSVAGRIAPYADDVVKKAVEVHKTEEEGTILAFLTSQAEVEWACERFIAPSAVALPLHG
KLSFEEQFRVFQNHPGKRKVIFATNIAETSLTIPGVKYVIDSGMVKESKYEPKTGMSILR
VCRVSQSSARQRAGRAGRTEPGRCYRLYSKHDFESMNLNQEPEIRRVHLGVALLRILALG
VDNAADFDFVDAPVPEAITMAVRNLVQLGAVVEKNGVLELTQEGHCLVKLGLEPKLGKLI
LGCFRYRMGKEGIVLAAVMANASSIFCRVGSLDEKMKADCLKVQFCNPNGDLFTLLSVYK
EWASLPRERRNKWCWENSLNAKSMRRCEDTVKELEICIERELSLVSPSYWAWNPTQGNKH
DKHLKMVILASLAENVAMYTGYDQLGYEVALTGQQVQLHPSCSLLAFGQKPNWVVFGELL
SVVDQYLVCVTAFDFEALSMLDPPPPFDASHMDEWRLRVEKVAGCSSTLLKRFCGKSNHG
LLSIVSRARSLCVDERISIQVDVDQNEILLYAPPHDMDKVSTLVNDALECEKKWMRNECL
EKYIYNGRGQVPMALFGSGAQIKHLEVDQRFLTVDVFYYGDSFVDDREVLRFLEKKIDGC
FCSIHKLVGNKQDCDEKDKWGRITFLTPETAMKATEIQKFDFNGSVLRLFPSLATGGGMF
KMPSFPSVNAMIRWPQRESTGRGVLKCPSGDVHSIFAGTSDIVIGTRYVRFETDQRFSDS
ILITNIDSGILEADVLDALEFYTGRTDLEFFLLRRKSVRCPPPAVCADMLHKRIYACMSS
SSSPEPNCVQVRVFEPKESDYFMRALITFDGRLHLEAAKALQELDGEVLPGCLSWQKIKC
EQKFQSSIICPASVYNIVRRQLNAKLTSFERQRGGTWHLEPTHGGAYRVRISAYATKPIS
EMRRSLEELVRGRPINHPGLTPRVLQHLSSRDGVILMRRIQHETETYILLDRHSLTVRIC
GSEEKIAAAEQELIRSLLAYHDRQQLEIRLRGPKLRPDLMKEVVNRFGPDLQGIKEKVNG
VDLKLNTRYHVIQVHGSIEMRQEVEKIVYELAQESSEPGGKPDDIEVECPICLCEVDDGY
TLEGCSHLFCKACLLEQLDASMRNFDAFPILCSHTDCGSPIVVADLRALLSQEKLDELFR
ASLSSFVTTSDGNFRFCSTPDCPSVYRVAGPRESGEPFICGACNAETCRKCHLEYHPYIT
CERYKLFKEDPDMSLKDWAKGKNVKECPFCKSTIEKSEGCNHVLCRCGKHICWVCLDFFT
HQEPCYEHMRAVHGGIGIFDGLGIPML
NT seq 5304 nt NT seq  +upstreamnt  +downstreamnt
atgagcagttcactccctcccgccgacggtggaagatcggcgactaatcgccactcctcc
ttcccctcagcttcaaccaaccgtcgaaacttcctctccccgccgctcaaccaccgacac
actcaccacaaccaccaccaataccctaactccagtttcccgccaaatcacaggcgcgat
cgacctccctcgccgccgaatttcgtcgtccagcttctccacccgagaatctcccccgcc
tccgccggcagcggcgacgccgccaagccgtctttctcggtcaggaagcaagtgatcagc
accctcgcctcgctgatcgggatcccggaggattcgatccacgtgcctcagttcggatgc
gtcgccgggagtttccgtttccgtcagtgggtcgacgcgctctccgccgtcgtctctctc
tgggagtaccgcctccaagggaagacccttttagtccccgagctggtcgctaacgtcacg
gtcccgtctgacgtggacgagcttagagacaggctccgtgctcttttctccgctcacgtg
acttcccttcttgacaacggagactgcgtcaagaaggtgagggcagagatagaggagaag
tctcgtcaagtcgagtccttttcgtccaagagaggtctcaagttggaagctttcgagaaa
aagaaggctcttgaggctgagagagatttgattgtgaagcgccttgaagaattcaagaat
ggtatgaagagcattgtgaggtttctcgaaggttctgtgcctgatggagaaaaagatgac
gtggcggtgtttagtttggaaggagcttatgattggccacgtattcatagcttgatccgc
agggagtgtcgtaggctagaggatggcctgcctatctatgcttacaggcggaatattttg
aagaggattcatggcgaacaggtaatggtattgattggagaaaccggttcagggaagagc
actcagttagttcagttccttgctgattccggagttgctgctagtgaatcgattgtttgt
acacagccaaggaaaatcgctgccttgacattagctgatcgggtcagagaagaaagcaat
ggttgttacgaggagaactctgtccgctgcactccagctttctcttctaccgaggagatt
agttccaaagtcgtgttcatgacggataactgtctgcttcaacactacattaaagatcgg
agcttgtctggagtttcttgcgttattattgacgaagctcatgagagaagcttgaacacg
gaccttcttctggcgttgcttaaagatctgatgtgcagaaggatcgacttgaggcttgtc
atcatgtctgctacggctgatgcttaccagctctcagactatttctttggctgtgggatt
ctttgtgtcaccggaaggaactttccggtggagattatatattcccctagtgacgcagaa
gggacttctgttgctggacgcattgctccgtatgctgatgatgttgttaagaaggcagtg
gaggttcataagacagaggaagagggaacaatccttgcgttcttgacttcccaagcggag
gttgaatgggcgtgcgaaaggtttatagctccatctgcagttgctttgcctttgcatgga
aagctttccttcgaggagcagtttagggtgttccagaaccatcctgggaaacggaaagtg
atctttgccacaaatattgcagagacctctctgactattcctggcgtcaagtatgtaatc
gattccgggatggtgaaagagagcaaatatgaacctaagactggtatgagcatcctcagg
gtttgccgagtcagtcagagttcagctcggcaacgtgctggtcgtgccggaaggacagaa
ccggggagatgttacagactttactcgaaacacgattttgagtcgatgaatctcaatcag
gaacctgagattcggagggttcatcttggtgtagcgctgttgaggattcttgctctgggt
gtagacaacgcagctgatttcgactttgttgacgcgcctgtccctgaagccatcacaatg
gctgtcagaaatcttgttcagttgggtgcagtcgttgagaagaatggtgttcttgagtta
acacaggaagggcactgtttagtcaagcttggtctggagccaaagcttggaaagttaatt
ttaggctgcttcagatacagaatgggcaaagaggggattgttcttgctgctgtcatggct
aatgctagtagtatattttgcagagttggcagcctcgatgaaaagatgaaagctgattgc
ctaaaggtacaattctgcaaccctaatggagacttgttcactcttctttcggtgtacaaa
gaatgggcatctctgccgcgagagagaagaaataaatggtgctgggaaaatagcttaaat
gccaaatcaatgaggagatgtgaagacacagtcaaggagttggagatatgcatcgagaga
gaactttctcttgtcagtccaagttactgggcttggaatccaacccagggtaataaacac
gacaagcatttgaaaatggttatacttgcatctcttgctgaaaacgtggcgatgtacact
ggctatgatcagcttgggtatgaggtggcattgactggtcaacaagttcagttgcatccg
tcctgttcattgctagcgtttggacagaagccaaactgggttgttttcggtgaacttcta
tcagttgtcgaccagtacttggtatgtgtaactgcgtttgattttgaagctttgtctatg
cttgatccacctccaccttttgatgcatctcatatggatgagtggaggctccgagtggaa
aaggtggctggttgtagcagcactctgctaaaaagattctgtgggaaatctaaccatggt
ctgctttcgattgtttctcgtgccaggtcgctttgtgtggatgaaaggattagtattcaa
gttgatgtcgatcagaatgagattctactgtatgcgcctccccacgatatggacaaagtc
tcgaccctagtgaacgatgcgttggagtgtgaaaagaaatggatgcgtaacgaatgcttg
gagaagtatatatacaatggtcggggacaagtacctatggcactttttggatctggtgct
cagataaagcatcttgaagttgatcagagattcttgacagtcgatgtattttattatggc
gacagttttgttgatgacagagaggttctgaggttcctggagaagaagattgatgggtgt
ttctgctctatccataagctcgttgggaacaagcaagactgtgatgagaaggataagtgg
ggtaggataacctttctcactccggaaactgctatgaaggcaacagaaattcagaaattt
gatttcaatggatcggtgcttagactatttccgtcactggcaactggtgggggaatgttc
aagatgccttctttcccttctgttaatgctatgattcgttggccgcagagggaaagcact
ggtagaggcgttcttaagtgcccatccggtgacgttcacagtatatttgctgggacctct
gacatagtgataggaacaagatatgtccggtttgagaccgatcaaaggttcagtgattca
atcttgattactaatattgactcaggtattttggaagcagacgttttagatgcgttggag
ttctatacggggagaacagatttggaattttttctattgagaaggaagagtgtgcggtgt
ccacctcctgctgtctgtgcagatatgctgcataagagaatatatgcgtgcatgtcatcc
agcagcagtccagagccaaactgtgtccaagtcagagtttttgaaccaaaagaatcagat
tacttcatgcgagccttgattacttttgatgggaggttacacttggaagctgcgaaagct
ttacaggagttagatggagaggtgctacctggatgcctttcatggcagaagataaaatgc
gagcaaaagttccagagctctattatctgtcctgcttctgtctacaacatagtcagaaga
caactgaatgctaagttaacaagcttcgagagacaaagaggaggtacgtggcatctggag
ccaactcatggtggtgcttaccgtgttagaatatctgcttatgcaaccaaacccatctcg
gagatgcggagatctcttgaagaactcgtaagaggaagacccataaaccatccaggctta
accccaagggtcttgcagcatctttcttccagagatggtgttattctgatgcggaggatc
caacatgagactgaaacttacattctattagacaggcacagtctcacagtacgcatttgt
ggatcagaagagaagattgctgcggctgaacaagaactgatccggtcacttctggcctat
cacgataggcagcaacttgaaatccgcctccgaggtcctaaactccgtcctgacctcatg
aaggaagttgtgaaccggtttggtccagacctccaaggtatcaaagagaaggtaaatggc
gtggatctcaagctcaacacccggtaccatgttattcaggttcatgggagcatagaaatg
aggcaggaagtagaaaagattgtgtacgaacttgcacaggaaagtagtgaaccgggcggg
aaaccagatgacattgaagttgaatgccccatttgcttgtgtgaggttgatgatggctac
actctcgaaggatgctcacacctcttctgcaaagcttgtctgttggaacagctcgatgcg
tcgatgagaaacttcgacgcatttcccatactttgctctcacacggactgtggatctcca
atagtagtcgctgatttgagagccctcttatcacaagagaagctagatgagctcttcaga
gcatccctgtcctctttcgtaacaaccagtgatggtaacttccggttttgctccacacct
gattgcccttccgtttaccgtgtagccggtcctcgagaatcaggggagccgttcatctgc
ggagcttgtaacgcagagacatgcagaaagtgccacctggagtatcacccgtatatcact
tgcgagaggtacaaactgttcaaggaggatccggacatgtcgttgaaagactgggcaaag
ggaaagaacgtgaaggagtgcccgttttgcaagtcgacgatagagaaatctgaagggtgt
aaccacgtgctgtgccggtgcgggaagcacatttgctgggtctgtttagacttcttcact
catcaagaaccttgttatgagcatatgagagcagtccatggtggaataggcatcttcgat
ggcctcggcatccccatgctttga

DBGET integrated database retrieval system