KEGG   Raphanus sativus (radish): 108848071
Entry
108848071         CDS       T06014                                 

Definition
(RefSeq) probable glutathione peroxidase 3, mitochondrial
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00480  Glutathione metabolism
rsz00590  Arachidonic acid metabolism
rsz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108848071
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108848071
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108848071
SSDB
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Other DBs
NCBI-GeneID: 108848071
NCBI-ProteinID: XP_018476980
UniProt: Q8W2D1
Position
Unknown
AA seq 197 aa
MPRSRSRVLILLLPLAFVFYLYRYLPSPAIVDQSSYSSIYHISVKDIDGNDVSLSKFTGK
VLLIVNVASKCGLTQGNYKELNILYAKYKTKGLEILAFPCNQFGSQEPGSNKEIKDNICT
TFKGEFPIFDKIEVNGENASPLYKFLKEQKGGLFGDSIKWNFAKFLVDKQGNVVDRFAPT
TSPLEIEKDIEKLLAST
NT seq 594 nt   +upstreamnt  +downstreamnt
atgcctagatcaagaagtcgcgtcctgattctcttattgcctctagcctttgtgttctac
ctgtacaggtacctgccttctccagctattgtcgaccaatcatcatacagctccatctac
cacatctccgttaaggacattgatgggaatgatgtgagtttaagcaagttcacaggaaag
gtgcttcttattgtcaatgtagcctctaagtgtggtctaacacagggaaactacaaagag
ttgaacattttgtatgccaagtacaaaactaaggggcttgagatcttagcgtttccctgc
aaccaatttggaagtcaagagccaggtagcaacaaggagattaaggataacatttgcaca
accttcaaaggagagtttcccatctttgacaagattgaagtgaatggtgagaatgcttca
cctctatacaagttcttgaaagaacagaaaggtggattgtttggggattctatcaagtgg
aacttcgcaaaatttctggtagacaaacaaggaaatgttgtggatcgatttgctcctaca
acatcacctcttgagattgagaaggacatagagaagctattggcatctacgtga

DBGET integrated database retrieval system