KEGG   Raphanus sativus (radish): 108849270Help
Entry
108849270         CDS       T06014                                 

Definition
(RefSeq) beta-glucosidase 3-like isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00460  Cyanoamino acid metabolism
rsz00500  Starch and sucrose metabolism
rsz00940  Phenylpropanoid biosynthesis
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108849270
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    108849270
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    108849270
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     108849270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 108849270
NCBI-ProteinID: XP_018478321
Position
Unknown
AA seq 499 aa AA seqDB search
MNKKILSMLTIILALASSGRCSNVYSRKDFPKGFSFGAGASAYQWEGAVDEDGRKPSVWD
TFVHSRNQDNGDITSDGYHKYKEDVQLMVETGLDAYRFSISWSRLIPNGRGPVNPKGLQF
YKNFIDLLVSNGIQPHVTLYHYDHPQDLEDEYGGWLNRRSIEDFTAYADVCFREFGNHVK
FWTTINEANIYTLGSYNDGLLPPGHCSSRSRCSSGNSSTEPYIVGHNLLLAHASASRLYK
QKYKDIQGGSVGFSVFTIGFAPTSSKNDEIAVQRAKAFYFGWMLGPLTYGDYPDEMKRIV
GSRLPLFTEEESALVKGSSDFVGVIHYLAVSVTSVTHVKSQREPNFYTDMGISMKFIGNY
TSFDYAIVPWAMEAVLEYIKESYGNPPVYILENGTPMKQNLQDTPRIEFLHAYIGAVLKS
IRKGSDTRGYFVWSFMDLYELLSGYEYSFGLYYVNFSDPRRKRTPKLSAHWYSAFLKDNT
TFLGSQVIAQLQSNFSSFY
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaagattttgtctatgcttaccattattttggctttggcgtcgtctgggaga
tgcagcaatgtttacagcaggaaagattttccaaagggcttttctttcggtgcaggcgct
tctgcttatcagtgggaaggagctgttgatgaagacggtagaaagccaagcgtatgggac
acttttgttcactctcgtaaccaagataatggagacataacatctgatgggtatcataag
tacaaggaagatgtgcagctgatggtcgaaactggcttagatgcctacagattctccata
tcttggtctaggcttataccgaatggaagaggtcccgtgaacccaaagggtctgcagttt
tacaagaacttcatcgacctacttgtaagcaatgggattcaaccacatgttacactctac
cactacgatcatcctcaggatctcgaggatgaatatggaggatggctcaacagaagaagc
atcgaagactttactgcttacgcagatgtttgcttcagagagtttgggaaccatgtcaaa
ttctggaccacgatcaacgaggcaaacatatacactcttggaagctacaatgatgggttg
ttaccgcctggtcactgctcctcacgaagtagatgctcgtcagggaactcttcgactgaa
ccatatatcgtaggccataacttgcttcttgcgcacgcctctgcttcaagactatataag
caaaagtacaaggatatacaaggaggttccgtaggctttagcgtatttacgatagggttt
gctcctacaagctccaagaatgatgagatcgcagttcaaagagctaaagctttctacttc
ggatggatgcttgggcctcttacatacggagactatcccgatgaaatgaaaagaatcgtt
ggatcgagactaccacttttcacagaggaagaatcagcattggttaaaggctcttctgac
ttcgtaggagtcattcactatcttgcagtttctgtgacttctgtcacacacgtcaaatcc
caaagagagcctaatttctacacagacatgggcatatctatgaaattcattgggaactat
acatctttcgactatgctattgttccatgggctatggaagctgtcctggagtatataaag
gagagctatggcaatcctcctgtctacattctagagaatggtacacctatgaagcagaat
ttgcaggacacaccaaggattgagttcttgcacgcctacattggtgctgttctcaagtcc
attaggaaaggatcagacacgagaggctacttcgtatggtcctttatggatctatatgaa
ttactaagcggatacgagtatagttttggattgtactatgtaaatttcagcgatcctcgc
cgcaagagaactccaaagctctctgctcactggtactctgcttttctcaaggacaacacc
acctttcttggttcccaagtcatcgcgcaattgcaaagcaacttttcttctttctactag

DBGET integrated database retrieval system