KEGG   Raphanus sativus (radish): 108849686
Entry
108849686         CDS       T06014                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00100  Steroid biosynthesis
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
Module
rsz_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108849686
Enzymes [BR:rsz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108849686
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 108849686
NCBI-ProteinID: XP_018478776
UniProt: A0A6J0N3Z7
Position
Unknown
AA seq 369 aa
MDLRLLLPSLIPSSQSVYVLVFYFVYLAVAGEILPGKVIRGVVLSDGSHLRYRCNGLLAL
TMLVTILGVSAKLGVLSPLVVADRGLELLSATFIFCVLVTLVLYITGRNSSDKSSSLKPH
ISGNLVEDWWFGIQLNPQFMSIDLKFFFVRAGMMGWLLINLSILAKSFQDGSLSQSMILY
QIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNKVELT
APAIVANCFVFLIGYMVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWGIARHC
NYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEERCAEKYKEIWAEYLRLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctccgtcttcttctaccatctctcattccctcatcgcaatccgtttacgtgctg
gtgttttacttcgtctacttggccgtcgccggagaaatcctccctggaaaagttatccgc
ggcgtcgttttgtcagatggctctcaccttcgttaccgatgcaatggtctactggcacta
acaatgctggtcactattttgggagtttctgcaaaactcggcgttttgtcacctcttgtg
gttgctgatagaggacttgagttgctctctgctacttttatcttctgtgttttggtgaca
ttggtattgtacatcaccgggcgcaattcttcggataagagttcttccctaaagcctcat
atctcaggaaatcttgtagaagactggtggtttggaatacagctgaatcctcagtttatg
agcatcgatctcaagtttttctttgtcagagccgggatgatgggatggctgcttatcaat
ctctctattctggcaaaaagttttcaggacggttccttgagtcagtccatgattctttac
cagattttctgtgcgttatatatattggactacttcgttcatgaagaatatatgacctcc
acgtgggacataattgcagagaggttggggttcatgctggtgtttggagatctcctgtgg
attcctttcacttttagcatccagggctggtggcttttgcacaacaaagtagaactaaca
gctcctgctattgtagccaattgctttgtgttcttgatagggtacatggtttttagaggg
gctaacaaacaaaaacatatctttaagaagaaccctaaaacacctatatggggtaagcct
ccagtggtggttggtggaaagttgcttgcttcaggctattggggaatcgcaaggcactgt
aattaccttggcgacttgatgcttgctctgtctttcagtttgccctgtggaataagttct
ccggttccatatttctacccgatatacctcctgatactgttgatatggagagagcgaaga
gacgaggaacgatgtgcagagaagtacaaggagatttgggctgagtatcttagactggtc
ccctatagaatccttccttatgtttattaa

DBGET integrated database retrieval system