KEGG   Raphanus sativus (radish): 108854278Help
Entry
108854278         CDS       T06014                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00630  Glyoxylate and dicarboxylate metabolism
rsz00710  Carbon fixation in photosynthetic organisms
rsz01100  Metabolic pathways
rsz01110  Biosynthesis of secondary metabolites
rsz01200  Carbon metabolism
Module
rsz_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rsz_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rsz_M00532  Photorespiration
rsz_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108854278
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108854278
Enzymes [BR:rsz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     108854278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 108854278
NCBI-ProteinID: XP_018483304
Position
Unknown
AA seq 181 aa AA seqDB search
MASSMLSSAAVVTSPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVSCMKVWP
PIGKKKFETLSYLPDLSDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGSTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKKEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTD
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctttcctccgctgctgttgttacctcacccgctcaagccaccatg
gtcgctccattcaccggcttgaagtcatccgctgcattcccagtcacccgcaaagcaaac
aacgacattacttccattgcaagcaacggaggaagagttagctgcatgaaggtgtggccg
ccaattggaaagaagaagtttgagaccctctcttaccttcctgacctttccgatgttgag
ttggctaaggaagtcgactaccttctccgcaacaagtggattccttgtgttgaattcgag
ttggagcacggatttgtgtaccgtgagcacggaagcacacccggatactatgatggacgg
tactggacaatgtggaaacttcccttgttcggatgcactgactctgctcaagtgttgaag
gaagtccaagaatgcaaaaaagagtaccctaacgccttcatcaggatcatcggatttgac
aacaaccgtcaggttcagtgcatcagtttcatcgcctacaaaccaccaagcttcaccgat
gcttaa

DBGET integrated database retrieval system