KEGG   Raphanus sativus (radish): 108854300Help
Entry
108854300         CDS       T06014                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108854300
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rsz03041]
    108854300
Enzymes [BR:rsz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108854300
Spliceosome [BR:rsz03041]
 Complex C
  Other components
   Step II factors
    108854300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE AAA DUF2075 Sigma54_activ_2 AAA_16 ABC_tran PhoH Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 108854300
NCBI-ProteinID: XP_018483326
Position
Unknown
AA seq 1185 aa AA seqDB search
MEKKELNKLNHLSLVSNICNELETHLGQAPKELAEYIIHLGRNSETADELDKKLKKDGAE
LPDYFVRSLLTVIHGIYPPRPKSDDVEEDGGGKGRFKGLAIGDTKDKVKELEKEIEREAQ
ERQREEDRNRGRDRRDSGRDRDRDRGRDRNRGDEDGGDRRGGRHDRERARGDDGRGDRYR
GRDRRDDEGGDRHRGGGSRGDDEGGDGRSDRRRDRGVQDEYTGANEPELYQVYKGRVTRV
MDSGCFVQFDRFRGKEGLVHVSQMATRRVDRAESVVKRDMEVYVKVVSIKEGGKYSLSMK
DVDQNTGRDLIPLKKPSDDDDLGRSNPSYRTKDGHVTKTGISGIRIVEESNVAPSRRPLK
KMSSPERWEAKQLIAAGALKASEFPDYDEDGDGMLYQEEGAEEELEIEMNEEEPAFLQGQ
TRYSVDMSPVKIFKNPEGSLSRAAALQSALTKERREMREQQQRTMLDSIPKDLNRPWEDP
MPETGERHLAQELRGVGLSAYDMPEWKKDAFGKTPTFGQRSKLSIQEQRESLPIYKLKKE
LIQAVHDNQVLVVIGETGSGKTTQVTQYLAEAGYTTKGKIGCTQPRRVAAMSVAKRVAEE
FGCRLGEEVGYAIRFEDCTGPDTVIKYMTDGMLLREILIDENLAQYSVIMLDEAHERTIH
TDVLFGLLKKLLKRRLDLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYTKQPE
SDYLDAALITVLQIHLTEPEGDILLFLTGQEEIDSACQSLYERMKNLGKNVPELIILPVY
SALPSEMQSRIFDPPPPGTRKVVVATNIAEASLTIDGIYYVVDPGFAKQNVYNPKQGLES
LVITPISQASAKQRAGRAGRTGPGKCYRLYTESAYRNEMPPTSIPEIQRINLGMTTLTMK
AMGINDLLSFDFMDPPQPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLEPPLSKML
LASVDLGCSDEILTMIAMIQTGNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWK
AKNFSGPWCFENFIQSRSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRKAITAGFFF
HGARKDPQEGYRTLVENQPVYIHPSSALFQRQPDWVIYHDLVMTTKEYMREVTVIDPKWL
VELAPRFFKVADPTHMSKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaggagctgaacaaattgaaccatctgtctctcgtctccaacatctgcaac
gagttggagacgcatctaggtcaagcgccgaaggagttggccgagtacatcatccatctc
ggtcgcaactccgagaccgccgatgaactcgacaagaagctgaagaaggacggcgcagag
cttcctgactacttcgtccgctcgctgctaaccgtaatccacgggatctaccctccgcgg
cccaagtccgacgatgtagaggaagatggaggagggaaggggagattcaaaggcttggcg
attggggatactaaggataaggtgaaggagctcgagaaggagattgagagggaggctcag
gagaggcagagagaggaggatcggaatagagggagggatcggagagattccggtagggat
agggatcgggatcggggtagagataggaatcgtggagatgaagatggtggagatagaaga
ggtggtaggcatgatagagaaagagcccgtggagatgatggaagaggggataggtataga
ggaagagaccgtagagatgatgaaggaggcgataggcataggggaggaggatcacgtggt
gatgatgaaggaggagatggaagaagtgataggcgtagagatcgtggtgtgcaggatgag
tacactggtgcgaacgagcctgagttgtatcaggtttacaaaggtagagtgactagggtg
atggactctggctgctttgttcagtttgataggtttagaggcaaagaaggtttggtacat
gtttctcagatggctacgagaagggttgatagggcagagagtgtggtgaagcgggatatg
gaggtgtatgtcaaagttgtatctattaaagagggtggtaagtacagtctttccatgaag
gatgttgatcagaacactgggagagacttgatcccgttgaagaagccttcagatgatgat
gatttagggaggagtaatccatcgtatagaacaaaggatgggcacgtcaccaagactggg
atttcagggatccggattgttgaggagagtaatgtcgcgccttcacgtaggccactgaag
aagatgagctcccctgagagatgggaagcgaagcagctcattgctgctggtgccttgaaa
gcatctgagtttccagattatgatgaggatggagatgggatgctttatcaagaggaaggt
gctgaagaagagcttgagattgagatgaatgaagaagaacctgctttcttgcaagggcaa
accaggtactctgttgacatgtctcctgttaagattttcaaaaacccggaaggttccttg
agccgtgctgctgcacttcagtctgcgctcaccaaggagaggagagaaatgagggaacag
cagcaaagaacaatgcttgactccatccctaaggatctgaatcgtccttgggaagaccct
atgcctgaaactggtgaaagacatcttgcacaggagctgagaggtgtcggtttatctgct
tatgacatgcctgagtggaagaaggatgctttcgggaaaactccaacttttggacaaaga
tcaaagctttctatccaggagcaaagagagagtcttcctatatacaagctgaaaaaggag
ctgatacaagctgtgcatgacaatcaagtgttggtggttattggtgagactgggtcaggg
aagacaacacaggttactcagtatcttgcagaagcaggttacacaacgaaaggaaagatt
gggtgtactcagcctcgtagggtcgctgcaatgtctgttgcaaagagagtagctgaggag
tttggttgtcgtttgggagaggaagtaggatatgcaattcggtttgaagattgcactgga
ccagatacggtaatcaagtacatgactgatggtatgcttcttagggagattctgattgat
gaaaacctcgcccagtactctgttattatgcttgatgaagctcatgagcggacaattcac
actgatgtgttgtttggtcttctaaagaagctgttgaaacgcaggcttgaccttcgtctg
atagtcacatcggccacattggatgcagagaaattttctgggtatttcttcaactgcaac
atctttacaattcccggaagaacattccctgtagagattctgtataccaaacagccagaa
agcgattacttggatgcagctctgatcacagttcttcagattcacttgactgagccagag
ggtgacattcttctctttttgacgggacaggaagaaattgattctgcatgtcagtctctg
tacgagagaatgaaaaatcttggtaaaaacgttcctgaactcatcatacttcctgtttac
agtgcccttcctagtgaaatgcagtccagaatatttgatcctccccctcctggtacccgg
aaagttgttgtagctacaaatattgcagaagcttctttgacaatagatggaatttattat
gttgttgatcctgggtttgcaaagcagaatgtgtataatccaaagcaaggactggaatcg
cttgtcattactccaatctcacaggcatcagcgaagcagagagctggacgtgctggtcgt
actggtccggggaaatgttaccgtctctacacagagagcgcttaccgcaatgagatgcct
cctacatcaatccctgaaatccagagaattaatcttggaatgacaaccctgaccatgaaa
gcaatgggtatcaatgacctgttgtcgtttgacttcatggatccaccccaaccgcaagca
ttgatctctgctatggaacagttgtacagtttgggagctttggatgaggaaggactgttg
acaaagctcggtagaaaaatggctgagtttcctcttgagccaccgctctctaagatgttg
ctagcgagtgtggatcttgggtgcagcgatgagattttaacaatgattgctatgatccag
acgggcaacatattttatagacctagagagaagcaagctcaagcagaccagaagagggct
aagtttttccaacccgaaggtgaccacttgactttgcttgctgtatatgaagcttggaag
gctaagaacttctcaggtccatggtgttttgagaacttcatacagtcgaggtcactacga
cgtgcacaagacgtgaggaaacagcttctcagcattatggacaaatataaactagacgtg
gtaagtgcggggaagaatttcacgaagataaggaaagcgatcacagcaggattcttcttc
catggagcaagaaaagatccgcaggaaggttacaggacgctggtggagaatcaaccggtg
tacattcacccgagcagtgcattgttccagagacaaccagattgggtgatataccatgac
cttgtgatgacgaccaaagagtacatgagagaagtgaccgtgattgaccccaagtggctt
gtggagctagctccaaggtttttcaaagtggctgatccaacccatatgagcaagcgtaag
cgccaggaacgcatagagcctctgtatgatcgttatcacgagcctaactcatggcgtctc
agcaaaagacgtgcttga

DBGET integrated database retrieval system