KEGG   Raphanus sativus (radish): 108862858Help
Entry
108862858         CDS       T06014                                 

Definition
(RefSeq) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00670  One carbon pool by folate
rsz01100  Metabolic pathways
rsz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    108862858
Enzymes [BR:rsz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     108862858
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-GeneID: 108862858
NCBI-ProteinID: XP_018492623
Position
Unknown
AA seq 634 aa AA seqDB search
MSSSSRKLQVVSPVPADIDIANSVEPLHIAEIAKDLNLSPLHYDLYGKYKAKVLLSAFDE
LKDREDGYYVVVGGITPTPLGEGKSTTTVGLCQALGAYLDKKVVTCLRQPSQGPTFGIKG
GAAGGGYSQVIPMDEFNLHLTGDIHAITASNNLLAAAIDTRIFHEASQSDKALFNRLCPV
NKEGKRSFSDIMFRRLTKLGISKTSPEELTPEEVKKFARLDIDPDSITWRRVMDVNDRFL
RKITIGQGPEEKGMTRETGFDISVASEIMAVLALTTSLGDMRERLGKMVIGNSKAGEPIT
ADDLGVGGALTVLMKDAIHPTLMQTLEGTPVLVHAGPFANIAHGNSSIVADKIALKLVGP
GGFVVTEAGFGSDIGTEKFMNIKCRYSGLTPQCAIVVATVRALKMHGGGPDVVAGRPLDR
AYVSENVSLVEAGCVNLAKHISNTKSYGVNVVVAVNMFSTDTEAELNAVKKFSMDAGAFD
AVICSHHAHGGKGAVDLGIAVEKACQNITQPLRFLYPLEISIKDKIEAIAKSYGASGVEY
SDQAEKQIEMYTQQGFSNLPICMSKTQYSFSHDASKKGAPSGFVLPIRDVRGSIGAGFIY
PLVGTMSTMPGLPTRPCFYEIDIDTVTGKVRGLS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgagttcatcatcaaggaagcttcaggtcgtttcgccagtccccgccgacatcgacata
gccaactccgtcgagcctctacacatcgccgagattgccaaagatctcaatctcagccca
cttcactacgatctctatggcaaatacaaagccaaggttctgttgtctgcgtttgatgag
cttaaagatcgagaagacggctactacgtagttgttggagggattactccaactcctctc
ggagaaggcaagtccaccaccactgttggcctttgccaagccctaggcgcttacctagac
aagaaggttgttacttgtcttcgccaaccctcgcaaggacctacctttggtatcaaagga
ggtgcagctggtggtgggtacagccaggtgattcccatggatgagttcaatcttcatctc
accggagacatccacgccatcactgcctccaacaacctcctagctgctgccatcgacact
aggattttccacgaggcgtctcagtcagacaaggctcttttcaacaggctgtgtcctgtg
aacaaagaagggaagcgtagcttcagtgatattatgtttaggaggttgactaagcttggg
atctccaagaccagtcccgaggagcttactcccgaggaggttaagaagtttgcgaggctt
gatatcgatcctgattctattacctggaggagagtgatggatgtgaatgatcggttcttg
aggaagatcactattggacaaggacctgaggagaaagggatgactagagagacagggttt
gatatctctgtggctagtgagattatggctgtgttggctttgacgacctctcttggtgac
atgagagagaggcttggcaaaatggtgattggtaacagcaaggccggggaaccgattaca
gctgatgatctcggtgttggaggagcattgactgttctgatgaaagacgctattcacccc
acgctcatgcagacgctcgaaggaactcctgtccttgttcacgctggtccctttgcaaac
atagctcatgggaactcgtctatagttgcggataagatcgcgttgaagctggtgggacct
ggcgggttcgtggtgacggaagctggttttggttctgacattggaacggagaagttcatg
aacattaagtgccgttacagcgggctgacgcctcagtgtgcgatcgttgtggccaccgtt
agggccttgaagatgcatggtggtggacctgatgttgtcgccgggaggcctcttgatcgc
gcctacgtgagcgagaatgtttccttggttgaagctggatgtgtgaatctggcaaagcat
atttcgaacactaaatcctacggtgtgaatgttgttgttgctgtgaatatgttctcaacg
gatacagaagcagagctgaatgcagtaaagaagttttctatggatgctggtgcttttgat
gctgtgatttgttcccaccatgctcatggtggcaaaggagcggttgatcttggtattgct
gttgagaaagcttgtcaaaacattactcagccacttaggtttctctacccattagagatc
agcatcaaagacaagattgaggccatagccaagtcgtatggagccagtggtgttgaatac
tctgaccaggctgagaagcagattgagatgtacactcaacaaggcttctccaaccttcct
atatgcatgtctaagacgcaatactcgttctcgcacgatgcatcgaagaaaggagcacct
tcagggtttgtgttgcctataagggacgtaagaggaagcattggtgctggattcatatat
ccactggttggtacgatgagtacaatgcctggacttccgacaagaccttgcttctatgag
atcgacatcgacactgtcactggaaaagttcgtggcctttcttga

DBGET integrated database retrieval system