KEGG   Ramlibacter tataouinensis: Rta_05490Help
Entry
Rta_05490         CDS       T01544                                 

Gene name
phhA
Definition
(GenBank) Candidate phenylalanine 4-monooxygenase (Phenylalanine-4-hydroxylase)
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00360  Phenylalanine metabolism
rta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rta00790  Folate biosynthesis
rta01100  Metabolic pathways
rta01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Rta_05490 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rta_05490 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rta_05490 (phhA)
Enzymes [BR:rta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     Rta_05490 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AEG91626
UniProt: F5XW56
Position
complement(576205..577065)
Genome map
AA seq 286 aa AA seqDB search
MAVEPVIYGASERPPRGDYARAGADYTCAQAYDSYTPADHDTYRRLYERQAALLPGRACD
EFIAALPSLGIKDRIPRFEEINERLYKATRWEVVGVPGLIPEVPFFTLLANRRFPVTDWI
RTPAEFDYIVEPDIFHDLFGHVPLLFDPVFADHVQAYGQGGLKAHGLGACELLSRLYWYT
VEFGLIRQKDGLRAYGAGILSSPGELQHAVQSREPQRLPLDIERVMRTRYKIDSYQSTYF
VIDSFRELFDKTAPDFTPLYERVRTLPPLAADARLDHEEDVQAVTA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcgaacccgtgatctacggcgccagcgagcggccgccacgcggcgactacgcg
cgcgccggcgccgactacacctgcgcccaggcctacgacagctacacgcccgcggaccat
gacacctaccggcgcctgtacgagcgccaggccgcgctgctgccggggcgcgcctgcgac
gagttcatcgccgccctgccgtcgctgggcatcaaggaccgcatcccgcgcttcgaggag
atcaacgagcggctgtacaaggccacgcgctgggaggtcgtcggcgtgccggggctgatc
cccgaggtgccattcttcaccctgctggccaaccgccggttcccggtgaccgactggatc
cgcacgccggccgagttcgactacatcgtcgaaccggacatcttccacgacctgttcggc
cacgtgccgctgctgttcgatccggtgttcgccgaccacgtgcaggcctacggccagggc
ggcctcaaggcgcacgggctgggcgcctgcgagctgctgagccgtctgtactggtacacg
gtggagttcggcctgatccgccagaaggacggcctgcgcgcctacggcgccggcatcctc
agctcgccgggcgaactgcagcacgcggtgcaaagccgcgagccgcagcgcctgccgctg
gacatcgagcgcgtgatgcgcacccgctacaagatcgacagctaccagtccacctacttc
gtgatcgacagcttccgcgaactgttcgacaagacggcgcccgatttcacgccgctgtac
gaacgggtgcggaccctgccgccgttggcggccgacgcccggctggaccacgaggaagac
gtgcaggccgtcacggcgtag

DBGET integrated database retrieval system