KEGG   Ramlibacter tataouinensis: Rta_10430Help
Entry
Rta_10430         CDS       T01544                                 

Definition
(GenBank) Acetyl-CoA synthase (Acetate thiokinase)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00010  Glycolysis / Gluconeogenesis
rta00620  Pyruvate metabolism
rta00640  Propanoate metabolism
rta00680  Methane metabolism
rta01100  Metabolic pathways
rta01110  Biosynthesis of secondary metabolites
rta01120  Microbial metabolism in diverse environments
rta01130  Biosynthesis of antibiotics
rta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rta00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rta_10430
   00620 Pyruvate metabolism
    Rta_10430
   00640 Propanoate metabolism
    Rta_10430
  Energy metabolism
   00680 Methane metabolism
    Rta_10430
Enzymes [BR:rta01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rta_10430
Lipid biosynthesis proteins [BR:rta01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rta_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEG92128
UniProt: F5Y0A6
Position
1081457..1083268
Genome map
AA seq 603 aa AA seqDB search
MAPSQNRDNHAALHASFRWQVPQRFNIAQACCTRWARSPGASRRIAVRAHSERGVPAVLS
YSELQAQADAVSRALRALGVQRGDRVAIVMPQRFETAVAYMAVFQLGAVAMPLSMLFGPE
ALEFRLCDSGAVVAICDDSSMANIAQVRERCPALRTVAGVGAAAAQCDADWLDWMRDRSG
AFDPVDTAADEAAVLIYTSGTTGPPKGALIPHRALIGNLPGFVCSQNWFGFDPARGGDSQ
AVFWSPADWAWTGGLMDALLPSLYFGRPIVAFNGRFSPELAFTLMQQHGVTHTFLFPTAL
KAMMKAFPRPRERFPLRLQAVMSAGEAVGDAVFAYCREQLGVTVNEMFGQTEINYVVGNC
SMEWAPTLPASRGSLPPEGAQPALGRPGGGLTAGRAVVGWPARPGSMGRPYPGHRVAVID
DAGNECPPGEPGDVAVHRCDVHGDLDPIFFLGYWNQEDATRRKFTGDWCRTGDLAVRDED
GYLWYQGRADDVFKAAGYRIGPGEIENCLVKHPAVANAAVVPKPDRERGAVVKAYVVLAP
GHAGGDSLVAELQQHVKGKLAPYEYPKEIEFIEQLPMTTTGKVQRRVLRLQEEERARAQA
AQP
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagtcaaaaccgggacaaccacgcggccctgcacgcgtcgttccgctggcag
gttccgcagcgcttcaacatcgcccaggcgtgctgcacgcgctgggcgcgctcgcccggc
gcttcgcgcaggatcgccgtgcgcgcccattcggagcggggcgtgcccgctgttctctcg
tattccgagctgcaggcgcaggccgacgccgtcagccgggccctgcgcgcgctgggcgtg
cagcgcggtgaccgggtcgccatcgtgatgccgcagcgtttcgagaccgccgtcgcctac
atggcggtgttccagctgggggcggtggccatgccgctgtccatgctgttcggccccgag
gcgctggagttccggctgtgcgacagcggggccgtggtggccatctgcgacgacagctcg
atggccaacatcgcgcaggtgcgcgagcgctgcccggcgctgcgcaccgtggcgggcgtg
ggcgcggccgccgcgcaatgcgatgccgattggctggactggatgcgcgaccggtccggc
gccttcgatcctgtcgacacggcggccgacgaggccgccgtgctgatctacaccagcggc
accaccggcccgcccaagggcgcgctgatcccgcaccgcgccctgatcggcaacctgccg
gggttcgtctgcagccagaactggttcggcttcgacccggcgcgcggcggcgactcgcag
gccgtgttctggtccccggcggactgggcgtggacgggcggcctcatggatgctttgttg
cccagcctgtacttcggccggcccatcgttgccttcaacggccgcttcagcccggagctg
gcgttcaccctgatgcagcagcacggcgtgacgcacaccttcctgttccccaccgcgctc
aaggccatgatgaaggccttcccgcggccgcgcgagcgcttcccgctgcggctgcaggcc
gtcatgagcgcgggcgaggcggtgggcgacgcggtgttcgcctattgccgcgagcagctg
ggcgtcaccgtgaacgagatgttcggccagaccgagatcaactacgtggtcggcaactgc
tccatggaatgggcccccacgctccccgcttcgcgtggttcgctgccccccgagggggcc
caacccgccttggggcggcccggcggcgggttgacggccggccgtgccgtggtgggctgg
ccggccaggccgggcagcatgggccgcccgtacccggggcatcgtgtcgcggtcatcgac
gatgcaggcaacgaatgcccgcccggcgagccgggcgacgtggcggtgcaccgctgcgac
gtgcacggcgaccttgaccccatcttcttcctgggctactggaaccaggaggacgccacc
cgccgcaagttcaccggcgactggtgccgcaccggcgacctggcggtgcgcgacgaggac
ggctacctctggtaccagggccgcgccgacgacgtgttcaaggcggcgggctaccgcatc
ggccccggcgagatcgagaactgcctggtcaagcatccggcggtggccaatgccgccgtg
gtgcccaagccggaccgcgagcgcggcgcggtggtcaaggcctatgtggtgctggcgccc
ggccacgccggcggcgactcgctggtggccgagttgcagcagcacgtcaagggcaagctc
gcgccctacgagtaccccaaggagatcgagttcatcgagcagctgcccatgaccaccacc
ggcaaggtgcagcggcgggtgctgcggctgcaggaggaggaacgcgcccgggcgcaggcc
gctcagccgtag

DBGET integrated database retrieval system