KEGG   Ramlibacter tataouinensis: Rta_12060Help
Entry
Rta_12060         CDS       T01544                                 

Gene name
pitA
Definition
(GenBank) Candidate phosphate/sulphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rta  Ramlibacter tataouinensis
Brite
KEGG Orthology (KO) [BR:rta00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Rta_12060 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Myc_target_1
Motif
Other DBs
NCBI-ProteinID: AEG92291
UniProt: F5Y1P0
Position
1236569..1237579
Genome map
AA seq 336 aa AA seqDB search
METAQAALWVVILLVALALAFDFMNGFHDAANSIATVVSTGVLRPGQAVLFAAFFNFVAI
FVFHLSVAATVGKGIVQPGVVDTHVVFGALVGAISWNVLTWYYGIPSSSSHALIGGIVGA
VIAKAGTGSLVGAGILKTVLFIFVSPTLGFLLGSLMMVIVAWGFRRSAPSRVDRWFRRLQ
LVSAGAYSLGHGGNDAQKTIGIIWMLLIATGYTASGAAAPPSWVVVSCYIAIAAGTMFGG
WRIVKTMGQKITKLKPVGGFCAETGGALTLFLATGLGIPVSTTHTITGAIVGVGSTQRAS
AVRWGVAGNIVWAWVFTIPASAFVAAVAYWISLQIF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgcacaggccgccctgtgggtggtgatcctgctggtggcgctggccctggcc
ttcgacttcatgaacggcttccacgacgcggcgaattccatcgccaccgtggtgtccacc
ggcgtgctgcgcccggggcaggccgtgctgttcgccgccttcttcaacttcgtcgccatc
ttcgtcttccacctgagcgtggcggccacggtgggcaagggcatcgtccagccgggggtg
gtggacacccacgtggtgttcggcgccctggtgggcgccatcagctggaacgtgctgacc
tggtactacggcatccccagcagttcctcgcatgcgctgatcggcggcatcgtgggcgcg
gtgatcgccaaggccggcaccggctcgctggtgggcgcgggcatcctcaagaccgtgctg
ttcatcttcgtctcgcccacgctgggcttcttgctgggctcgctgatgatggtgatcgtg
gcctggggcttccgccgctcggccccctcgcgggtggaccgctggttccggcggctgcaa
ctggtctcggcgggcgcctacagcctgggccacggcggcaacgacgcgcagaagaccatc
ggcatcatctggatgctgctgatcgccaccggctacaccgcctcgggcgcggcggcgccg
ccgagctgggtggtggtcagctgctacatcgccatcgcggccggcaccatgttcggcggc
tggcgcatcgtcaagaccatgggccagaagatcaccaagctcaagccggtgggcggcttc
tgcgccgagaccggcggcgcgctgacgctgttcctggccacgggactggggatcccggtg
tcgaccacccacaccatcaccggcgccatcgtaggggtgggctccacccagcgcgccagc
gccgtgcgctggggcgtggccggcaacatcgtctgggcctgggtcttcaccatcccggcc
agcgccttcgtggcggcggtggcctactggatcagcctgcagatcttctag

DBGET integrated database retrieval system