KEGG   Ramlibacter tataouinensis: Rta_15950Help
Entry
Rta_15950         CDS       T01544                                 

Definition
(GenBank) bifunctional protein : Nicotinamide-nucleotide adenylyltransferase (NAD(+) pyrophosphorylase)-like protein
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00760  Nicotinate and nicotinamide metabolism
rta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rta_15950
Enzymes [BR:rta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Rta_15950
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     Rta_15950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: AEG92686
UniProt: F5Y5J0
Position
complement(1677948..1678952)
Genome map
AA seq 334 aa AA seqDB search
MTQAPPRQAHAVCVGAFTLPSAGDVRTVREALAEIGRCRVLIASAHLPRSPRTPFTWQER
AAMLRDSLDGAEAARVEFVPLREWFDDARNAQALQQAADAAGVARDAVRRCGPARDESMT
PGDPGMRDLHPELFAADDAQAALATLRGRVAPGTAAFLQGWLGMPDHQRLREEWQQIARE
RALWAAVPYPVTLVTVDAVVRAAGHVLLIRRGRHPGKGLRALPGGFLETRETLAHAAIRE
LLEETQLDVPEAQLWACLKAVRAFDHPWRSQRNRIIVHAHFFDLPGGTLPRVQGADDAAH
AEWVPVADLPGLDGQFLDDHLVILDHLLRGLGLR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcgccgccgcgacaggcgcacgccgtgtgcgtgggggctttcaccctgccc
agtgcaggcgatgtgcggaccgtgcgcgaggccctggccgaaatcgggcgttgccgcgtg
ctcatcgcgtccgcccacctgccgcgttcgccgcgcacgcccttcacctggcaggagcga
gcggcgatgctgcgcgactcgctcgacggcgcggaagccgcacgtgtggagttcgtgccg
ttgcgcgaatggttcgacgatgcacgcaacgcgcaggcactgcagcaggctgcggacgcg
gccggcgtggcgcgggacgcagtgcggcgctgcggcccggcacgcgacgagtcgatgacg
ccgggcgacccaggcatgcgcgacctccatccggagctgttcgccgccgacgacgcgcaa
gccgcgctggcaaccctgcgcggtcgcgtggcgcccggcacggcggcgttcctgcaaggc
tggctgggaatgccggaccatcaacggctgcgcgaggaatggcagcagatcgcgcgcgag
cgggccctctgggcggccgtcccctacccggtgacgctggtgacggtggacgccgtggtg
cgcgccgccggccacgtgctgctgatccgccgcggccgccatcccggcaagggcctgcgc
gccctgcccggcggcttcctggagacgcgcgagacgctggcgcatgctgccatccgggag
ctgctggaggagacgcagctcgacgtgcccgaggcgcagctgtgggcgtgcctgaaggcg
gtgcgggcgttcgaccatccctggcgcagccagcgcaaccgcatcatcgtccacgcccat
ttcttcgacctgcccggcggcacgctgccgcgtgtgcagggcgcggacgacgcggcccac
gccgagtgggtgccggtggccgacctgcccgggctggacgggcagttcctggacgaccac
ctggtgatcctggatcacctcctgaggggactggggctgcgttag

DBGET integrated database retrieval system