KEGG   Ramlibacter tataouinensis: Rta_16030Help
Entry
Rta_16030         CDS       T01544                                 

Definition
(GenBank) CDP-tyvelose-2-epimerase (CDP-paratose 2-epimerase)-like protein
  KO
K12454  CDP-paratose 2-epimerase [EC:5.1.3.10]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00520  Amino sugar and nucleotide sugar metabolism
rta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rta_16030
Enzymes [BR:rta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.10  CDP-paratose 2-epimerase
     Rta_16030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 Polysacc_synt_2 RmlD_sub_bind KR adh_short NAD_binding_10 NAD_binding_8 NmrA
Motif
Other DBs
NCBI-ProteinID: AEG92694
UniProt: F5Y5J8
Position
complement(1686259..1687329)
Genome map
AA seq 356 aa AA seqDB search
MSEESLALITGGAGFVGSNLAHRLLGAGRRVRILDNLSRPGVEQNLQWLRQAHGAQLDVV
VADIRDAQAVQRAMVGVHQVFHFAAQVAVTTSLEDPQEDFAINAQGTLNVLEAARARPLP
PAILLTSTNKVYGGLGDVALGLEGQRYLPVDEEVRRRGIGEARPLDFHSPYGCSKGTADQ
YVVDYARSYGLTTCVFRMSCIYGPRQFGTEDQGWVAHFLLRALRGESITLYGDGKQVRDV
LFVDDLVDAFLLAEQNAARLSGRAFNIGGGPGSTISLLDLVDRIERLQGQRPALAFDDWR
TGDQRYYVSDTRAFEQATGWRRRVEAEDGIARLYRWLAEREQAGAPRRVAVEAGAH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggagtcgctggcgctcatcaccggcggcgccgggttcgtgggctccaacctg
gcccatcgcctgctcggcgccggccgccgcgtgcgcatcctggacaacctgtcccgcccg
ggcgtggagcagaacctgcagtggctgcgccaagcgcatggcgcccagctggacgtggtg
gtggccgacatccgcgacgcgcaggccgtgcagcgcgccatggtcggcgtgcaccaggtc
ttccacttcgccgcccaggtggcggtgaccaccagcctggaggacccccaggaggacttc
gccatcaacgcgcagggcacgctgaacgtgctggaggcggcccgcgcccgcccgctgccg
ccggccatcctgctgacctcgaccaacaaggtctacggcgggctgggcgacgtggcgctc
ggcctggagggccagcgctacctgccggtggacgaggaggtgcgccggcgcggcatcggc
gaggcccgcccgctggacttccacagcccctacggctgctccaagggcacggccgaccag
tacgtggtcgactacgcgcgcagctacggcctgacgacttgcgtgttccgcatgagctgc
atctacgggccgcgccagttcggcaccgaggaccagggctgggtcgcgcacttcctgctg
cgggcgctgcgcggcgaatccatcacgctctacggcgacggcaagcaggtgcgcgacgtg
ctgttcgtggacgacctggtcgacgccttcctgctggccgagcagaacgccgcgcgcctg
tcgggccgggccttcaacatcggcgggggccctggcagcaccatcagcctgctggatctg
gtcgaccgcatcgagcgcctgcaaggccagcgcccggcgctggccttcgacgactggcgc
accggcgaccagcgctactacgtctccgacacccgggccttcgagcaggccaccggctgg
cgccggcgcgtcgaggccgaggacggcatcgcccgcctctaccgctggctggccgaacgc
gagcaggccggcgcgccgcgccgcgtggccgtcgaggcaggcgcgcactga

DBGET integrated database retrieval system