KEGG   Ramlibacter tataouinensis: Rta_18100Help
Entry
Rta_18100         CDS       T01544                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase-like protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rta  Ramlibacter tataouinensis
Pathway
rta00071  Fatty acid degradation
rta00072  Synthesis and degradation of ketone bodies
rta00280  Valine, leucine and isoleucine degradation
rta00310  Lysine degradation
rta00362  Benzoate degradation
rta00380  Tryptophan metabolism
rta00620  Pyruvate metabolism
rta00630  Glyoxylate and dicarboxylate metabolism
rta00640  Propanoate metabolism
rta00650  Butanoate metabolism
rta00900  Terpenoid backbone biosynthesis
rta01100  Metabolic pathways
rta01110  Biosynthesis of secondary metabolites
rta01120  Microbial metabolism in diverse environments
rta01130  Biosynthesis of antibiotics
rta01200  Carbon metabolism
rta01212  Fatty acid metabolism
rta02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rta_18100
   00630 Glyoxylate and dicarboxylate metabolism
    Rta_18100
   00640 Propanoate metabolism
    Rta_18100
   00650 Butanoate metabolism
    Rta_18100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rta_18100
   00072 Synthesis and degradation of ketone bodies
    Rta_18100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rta_18100
   00310 Lysine degradation
    Rta_18100
   00380 Tryptophan metabolism
    Rta_18100
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rta_18100
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rta_18100
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rta_18100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rta04147]
    Rta_18100
Enzymes [BR:rta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rta_18100
Exosome [BR:rta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rta_18100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AEG92900
UniProt: F5XWE6
Position
1901757..1902938
Genome map
AA seq 393 aa AA seqDB search
MEDIVIVSAARTAVGKFGGSLAKIPATELGSVVIKEALARARVDPAQVGEVIMGQVLAAG
AGQNPARQALLKAGLPKEVPGLTINAVCGSGLKAVMLAAQAVAWGDSEIVVAGGQENMSA
APHVLMGSRDGQRMGDWKMVDSMIVDGLWDVYNQYHMGITAENVARQHSIDRAAQDALAL
ASQQKAAAAQEAGRFKDEIVPVAIPQKKGEPLRFDADEFINKKTSAEALGGLRPAFDKAG
TVTAGNASGINDGAAAVVVMSAKKAAQLGLKPLARIAAFGTSGLDPATMGMGPVPASRKA
LQRAGWNVQDVQLFELNEAFAAQACAVNKELGIDPAKVNVNGGAIAIGHPIGASGCRILV
TLLHEMQRREARKGLAALCIGGGMGVSLAVERA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtctcggccgcccgcaccgcggtcggcaagttcggcggctcg
ctcgccaagatcccggccacggagctcggctccgtcgtcatcaaggaagcgctggcccgc
gccagggtggatcccgcccaggtgggcgaggtgatcatgggccaggttctggccgccggc
gccggccagaacccggcgcgccaggcgctgctgaaggccggcctgcccaaggaggttccc
ggcctgacgatcaacgcggtgtgcggctcgggcctgaaggccgtgatgctggcggcgcag
gccgtcgcctggggcgacagcgagatcgtggtggccggcggccaggagaacatgagcgcc
gccccgcacgtgctgatgggctcgcgcgacggccagcgcatgggcgactggaagatggtc
gattccatgatcgtggacggcctgtgggacgtctacaaccagtaccacatgggcatcacc
gcggagaacgtggccaggcagcacagcatcgaccgtgctgcccaggacgcgctggcgctg
gccagccagcagaaggccgccgctgcccaggaagccggcaggttcaaggacgagatcgtg
ccggtcgccatcccgcagaagaagggcgagccgctgcgcttcgatgccgacgagttcatc
aacaagaagaccagcgccgaggcgctgggcggcctgcgcccggcgttcgacaaggccggc
accgtgaccgccggcaatgcctcgggcatcaacgacggcgccgccgccgtggtggtgatg
agcgcgaagaaggccgcgcagctgggcctcaagccgctggcgcgcatcgccgccttcggc
acctcggggctggatcccgcgaccatgggcatgggcccggtgccggcctcgcgcaaggcg
ctgcagcgcgccggctggaacgtgcaggacgtgcagctgttcgagctcaacgaggctttc
gccgcccaggcatgcgcggtcaacaaggagctgggcatcgacccggccaaggtcaacgtc
aacggcggtgccatcgccatcggccatccgatcggcgcctcgggctgccgcatcctggtg
acgctgctgcacgagatgcagcggcgcgaggcgcgcaagggcctggcggcgctgtgcatc
ggcggcggcatgggggtttccctcgcggtggaacgcgcctga

DBGET integrated database retrieval system