KEGG   Rickettsia typhi B9991CWPP: RTB9991CWPP_03255Help
Entry
RTB9991CWPP_03255 CDS       T01810                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
rtb  Rickettsia typhi B9991CWPP
Pathway
rtb00450  Selenocompound metabolism
rtb00970  Aminoacyl-tRNA biosynthesis
rtb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    RTB9991CWPP_03255
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RTB9991CWPP_03255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rtb01007]
    RTB9991CWPP_03255
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rtb03016]
    RTB9991CWPP_03255
Enzymes [BR:rtb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     RTB9991CWPP_03255
Amino acid related enzymes [BR:rtb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   RTB9991CWPP_03255
Transfer RNA biogenesis [BR:rtb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    RTB9991CWPP_03255
 Prokaryotic type
   Other AARSs
    RTB9991CWPP_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AFE55354
Position
complement(859039..860562)
Genome map
AA seq 507 aa AA seqDB search
MKNTYYITTPIYYVNDVSHIGHAYTSVASDVIARFMRCCGKDVMFLTGTDEHGQKVEKAA
INKNIDPQSFTDKTSQNFRDLMVAMNISNDDFIRTTENRHKKAVAVFWQKLLDNGAIYEG
FYEGWYSVRDEAFYDESEITEDKLAPTGAPVEWVKEPSYFFNLAKWQDKLLEFYELNPDF
VRPISRRNEVISFVKSGLKDLSISRTTFNWGIKVPNNEKHVIYVWLDALVNYISALGYPD
QQSNYSKFWPANLQVVGKDILRFHAVYWPAFLMAAEISPPKSIMVHGWWTNAGQKISKSL
GNTIDPITLIDEFGVDQVRYFLMREVIFGADANFTRNNLITRINSELSNKIGNLLHRIVS
FVYNNNDAKVPLIKSGVIDKIYELPILKTAMKFAQENILLMDKIEINKILENIINLAEDA
NIYIANEAPWNLKKTDYDKMLEVLYTLLEVLRYVAIMLQPFVPSSANKMLDQLGVAKEER
LFKHLVRDHALKAGSNILEPSIIFPKI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatacttactatattactacccctatatattatgttaatgatgtttcccatatt
ggtcatgcttatactagtgttgcaagtgatgtgattgcccgttttatgcgttgttgcggt
aaggatgtaatgtttttaacaggtactgatgaacatggacagaaagtagaaaaagcagct
attaataaaaatattgatcctcaatcatttactgataagacatcacaaaattttcgtgat
cttatggttgcaatgaatatttctaatgatgattttattaggacaactgaaaatagacat
aaaaaagctgtagcagttttttggcagaaattactagataatggtgcaatctatgaagga
ttttatgagggttggtattcagtgcgtgatgaggctttttatgatgaatcagagatcact
gaagataaattagcaccgactggagcacctgttgaatgggttaaagagccaagctatttc
tttaatcttgcaaaatggcaagataaattacttgagttttatgagctaaaccctgatttt
gtcagaccaatatcaaggcgtaatgaagtgattagctttgttaaatcaggtctaaaggat
ttatccatatcacgtactacttttaattgggggatcaaagttccaaataatgaaaaacat
gtgatttatgtttggcttgatgcgcttgttaattatatttcagcacttggttatcctgat
caacaaagtaattatagtaaattttggcctgctaatttacaagtagtaggtaaggatatc
ttgcgttttcacgctgtatattggcctgctttcttaatggctgcagaaatttcaccgccg
aagtcaattatggttcatggttggtggactaatgcgggacagaagatttctaaatctctt
ggtaataccattgatccgattacattaatcgatgaattcggtgttgatcaggtgaggtat
tttcttatgcgtgaagtaatttttggtgcagatgctaattttactcgtaataatttaatt
acacgtattaatagcgaactttcaaataaaataggtaatttattacatcgtattgtatct
tttgtgtataacaataatgatgctaaagtgcctttgattaagtcaggtgttatagataaa
atatatgagctcccgattttaaaaaccgcaatgaaatttgctcaagagaatattttattg
atggataaaatagagattaataaaattcttgaaaatattattaatttggctgaagatgca
aatatctatattgctaatgaagcgccttggaatttaaaaaaaactgattatgataagatg
ttagaggtgttatatactctgctagaagtactacgttatgttgcaataatgcttcagcct
tttgtaccaagttccgcaaataaaatgctagatcagttaggggttgctaaagaagagaga
ttatttaagcatctagtacgtgatcatgctttaaaagcaggtagtaatattttagagcct
agtataatttttccaaaaatttaa

DBGET integrated database retrieval system