KEGG   Raoultella terrigena: NCTC13098_06401Help
Entry
NCTC13098_06401   CDS       T06046                                 

Gene name
aldH
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
rtg  Raoultella terrigena
Pathway
rtg00040  Pentose and glucuronate interconversions
rtg00053  Ascorbate and aldarate metabolism
rtg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NCTC13098_06401 (aldH)
   00053 Ascorbate and aldarate metabolism
    NCTC13098_06401 (aldH)
Enzymes [BR:rtg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     NCTC13098_06401 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: VDR29972
UniProt: A0A3P8L2G3
Position
1:complement(5347131..5347943)
Genome map
AA seq 270 aa AA seqDB search
MFAEMSAINPLIILPQALASRAPLLAKELVASFTLGGGQFCTRPGLILVLKGADSERFRA
ALCEQVRAAAAQVLLNAPTREHYHASVAALDASPGVQRLAAGQAAEGAQAQALLYQATAE
QVMAADSLLQREVFGPLSVLVEAADEAQLQALLQSLQGQLTATLHAETDDRPLASRLLPL
LSEKAGRVLFNGYPTGVEVCDAMVHGGPWPATTDARGTSVGTRAIERFLRPVCLQNAPAA
LLPAALQDANPLNLLRLVNGQWTREAISPL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccgaaatgtcggccatcaatccgctgattatcctgccgcaggcgctggcctcc
cgcgcgccgctgctggcaaaagagctggtggcgtcctttaccctcggcggcggccagttt
tgtacccgtcccggcctgatcctcgtgctcaagggagcggacagcgagcgcttcagggcg
gccctctgcgagcaggtgcgcgccgccgccgcgcaggtgctgctgaatgcgccgacgcgc
gagcactatcacgcgagcgttgcggctctcgacgccagccccggcgtgcagcgtctggcc
gccggccaggccgcagagggcgcgcaggcgcaggccctgctgtatcaggcgacggcggag
caggtgatggccgccgactctctgctccagcgtgaagtctttggcccgctgtcggtgctg
gtggaagcggccgatgaggcccagcttcaggccctgcttcagagcctgcaggggcagctc
accgccacgctgcacgcggagactgacgatcgtccgctggcgtcgcgcctgctgccgctg
cttagcgagaaggcgggacgggtgctgttcaacggctatcccaccggggtcgaggtgtgc
gatgcgatggtccacggcgggccctggccggccaccaccgacgcgcgcggtacctcggtc
ggcacccgggcgattgagcgctttctgcgcccggtttgcctgcagaacgcgcccgccgcg
ctgctgccggcggccctgcaggatgcgaaccctttaaacctgctgcgcctggtgaacggg
cagtggacacgggaagcgatttccccactctga

DBGET integrated database retrieval system