KEGG   Rufibacter tibetensis: DC20_16960Help
Entry
DC20_16960        CDS       T04099                                 

Definition
(GenBank) cobalt transporter
  KO
K06195  ApaG protein
Organism
rti  Rufibacter tibetensis
Brite
KEGG Orthology (KO) [BR:rti00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DC20_16960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Antig_Caf1 DUF4354
Motif
Other DBs
NCBI-ProteinID: ALJ00351
UniProt: A0A0P0CUN4
Position
complement(4156789..4157175)
Genome map
AA seq 128 aa AA seqDB search
MDTKTTQGVTVNVTTNYLPDYSSPAQQHFVFAYKITIQNNSEFTVKLLRRHWHIFDSNNE
IREVEGEGVVGQQPVLEPGESHQYVSGCNLKTSIGKMAGTYLMERLVDGRQFHVTIPEFT
LIIPYKLN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggatacgaaaacaacccaaggagtcactgtcaacgtcacgacaaattacctccctgac
tattctagtccggctcaacagcactttgtcttcgcttataagatcactatccagaacaac
agcgaattcacggtaaagttactacgtcgtcactggcatatctttgattctaataacgag
atacgtgaggtggaaggtgaaggtgtggtaggccaacaacctgtgctggaacccggtgaa
agccaccagtacgtctcgggctgtaacctcaaaaccagcattggtaaaatggcaggtact
tacctgatggagcgtctggtagacggccgtcaatttcacgtgaccattcctgagttcacg
cttataattccttataaactcaactaa

DBGET integrated database retrieval system