KEGG   Rufibacter tibetensis: DC20_17425Help
Entry
DC20_17425        CDS       T04099                                 

Definition
(GenBank) hypothetical protein
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rti  Rufibacter tibetensis
Pathway
rti00360  Phenylalanine metabolism
rti00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rti00790  Folate biosynthesis
rti01100  Metabolic pathways
rti01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rti00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DC20_17425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DC20_17425
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DC20_17425
Enzymes [BR:rti01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DC20_17425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ALJ00426
UniProt: A0A0P0CLC5
Position
4268743..4269498
Genome map
AA seq 251 aa AA seqDB search
MYQQQYHQYTIQQQQTWNILYTKRAEALSATVSAPFWAGINALELKAYFIPDFQKVNFLL
KRLNEWEVVAVEEPLRPRQVLARWAKQKFPAVTSLRVHPDANLCLQGNQDLFQDVFGQLP
WLLVPEVADFMQRVGQLSVQAKDPAATELLWRLVQHVLGNGLLRDPEGKVTLFGFHLVSS
TSEANLAFAREDAWKPIMLEEILGQPFKEGERPSTYFVLEALSDLTQLVEQLEKEGVPVV
EIPAQWSLLVG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtatcagcaacagtaccaccagtacaccatccagcagcaacagacctggaacattttg
tacaccaagcgggcagaagcactttcggccacggtatctgcgcccttctgggcaggtatt
aacgcgctggaactgaaggcttattttattccagatttccagaaagtcaacttcttactg
aagcggcttaatgaatgggaggtagtggcagtagaagaaccgcttcgtccgcggcaggtg
ttggcccggtgggcaaagcagaagtttccggcggtcacctctttacgggtgcacccagac
gcaaacttgtgtttgcaaggaaatcaggacttgtttcaggatgtgtttgggcagttgccc
tggttgctggtaccagaagttgcagacttcatgcagcgggttggacaattgtctgtgcag
gccaaagatccggctgctactgagttactatggcgcttggtgcagcacgtacttggcaat
ggactcttgcgtgatcctgaaggcaaagtgaccttgtttggtttccacttggtatcttct
actagtgaagccaatctggcttttgctagggaagatgcatggaagcctattatgctggag
gaaatcttgggccagccctttaaagaaggggaaagaccaagcacctactttgtgttagaa
gctctttctgacttaacccaacttgtggagcagttggagaaagagggagttccagtggtg
gagattccagctcagtggagcttgttagttggctga

DBGET integrated database retrieval system