KEGG   Rathayibacter tritici: A6122_0841Help
Entry
A6122_0841        CDS       T04388                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rtn  Rathayibacter tritici
Pathway
rtn00220  Arginine biosynthesis
rtn00330  Arginine and proline metabolism
rtn01100  Metabolic pathways
rtn01110  Biosynthesis of secondary metabolites
rtn01130  Biosynthesis of antibiotics
rtn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rtn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A6122_0841
   00330 Arginine and proline metabolism
    A6122_0841
Enzymes [BR:rtn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A6122_0841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AND15994
UniProt: A0A160KRQ3
Position
complement(970523..971356)
Genome map
AA seq 277 aa AA seqDB search
MASFLVVPQWQGSASTRAMRLVDGAEAIRGDLPSSATTALEVPTEAGDAQDTGVRRYASI
ATVAERVREALAGRTEPVITIGGDCGVEFAAIGHAVRTAAGPVALVWLDAHPDAHTPDSS
SSGAFCGMVLAAALGRGVGVLSAGADERVADENVVLAGVRSADEGELEPLVERGAAVIAA
DALGPESLVAAVEATGAASVYVHVDLDVLDPADLAGLFDPVPFGVPASRLVASLDALRAR
FPLAGAGVTSFAPSSPAAAEEDLPTILRLLGALSRGA
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcctccttcctcgtcgtcccccagtggcagggctcggcatcgacgcgcgcgatgcgc
ctcgtcgacggagctgaggcgatcaggggcgatctaccctcctccgccaccaccgccctc
gaggtgcccaccgaggcgggcgacgcgcaggacaccggcgtccgccgctacgcctcgatc
gcgaccgtcgccgagcgggtgcgggaggctctcgccggtcgcaccgagcccgtgatcacg
atcggcggcgactgcggcgtcgagttcgcggcgatcgggcacgccgtccgcactgctgcg
ggcccggtcgcgctggtgtggctcgacgcgcatccggatgcacacacgcccgactcttcc
agcagcggtgcgttctgcggcatggtcctcgcggcggcgctgggccgtggcgtgggcgtg
ctgagcgccggcgccgacgagcgggtggcagacgagaacgtcgtcctcgccggagtacgc
tccgctgacgagggagagctcgagcccctggtcgagcgcggcgccgcggtgatcgccgcc
gacgccctcggccccgagtcgttggtcgctgccgtcgaggccacgggtgccgcctccgtg
tacgtgcacgtcgatctggatgtgctcgaccccgctgatctcgccggcctgttcgacccg
gtgcccttcggagtccccgcctcccggctcgtggcgagcctggacgctctgcgggcccgc
ttcccgctcgcgggcgccggagtcacctccttcgctccgtcctcaccggccgcggccgag
gaagacctacccacgatcctccgcctgctcggcgctctgtcccgcggggcctga

DBGET integrated database retrieval system