KEGG   Rathayibacter tritici: A6122_0903Help
Entry
A6122_0903        CDS       T04388                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
rtn  Rathayibacter tritici
Pathway
rtn00030  Pentose phosphate pathway
rtn00480  Glutathione metabolism
rtn01100  Metabolic pathways
rtn01110  Biosynthesis of secondary metabolites
rtn01120  Microbial metabolism in diverse environments
rtn01200  Carbon metabolism
Module
rtn_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
rtn_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:rtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A6122_0903
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6122_0903
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtn04147]
    A6122_0903
Enzymes [BR:rtn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A6122_0903
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A6122_0903
Exosome [BR:rtn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A6122_0903
  Exosomal proteins of colorectal cancer cells
   A6122_0903
  Exosomal proteins of bladder cancer cells
   A6122_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AND16056
UniProt: A0A160KR38
Position
1048153..1049526
Genome map
AA seq 457 aa AA seqDB search
MVQTVSTLLILGATGDLSSRLLLPAVGQLLARESDRRVHLVGAGREDWTQEHWREVLTSS
FATVEATGAGVDALRSGTRYQQVDVTDPEALAALLASCEGPVAVYFALPPAIAAKACEAL
AAHDLPEGTVLALEKPFGTDQPSAHALNERLAALVPEDRIHRVDHFLGRATVMNVLGLRF
ANRILEPLWSAEHIASVEIVYDEQLALEGRASYYDTAGALTDMIQSHLLQVLAVIAMEPP
STLDAADLRDAKSIVLRATRLHGDDAASSSRRARYTAGTIDGRELPSYADEKGVDPARTT
ETLAELVVEIDTWRWAGVPFTLRSGKALGERRREVVIRFKPVPHLPRGFHGAEEPSVLRL
FLAPDKMALELSINGPGDPYTLERASLEAVFGAGELLAYGEVISGILDDDPSLSVRGDAA
EECWRIVQPAIDAWHADAVPLDEYPAGSDGPEGWPTV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtacagactgtctcgaccctgctcatcctcggagcgacgggagacctgtcctcgcgg
ctgctcctgcccgccgtcggccagcttctggcccgcgagagcgaccggcgcgtgcatctc
gtcggtgccgggcgcgaggactggacccaggagcactggcgcgaggtgctgaccagctcc
ttcgccaccgtcgaggcgaccggtgcgggggtggacgcgcttcgctccggcacgcgctac
cagcaggtcgacgtgacggatccggaggcgctcgccgcgctgctcgcgagctgcgagggg
cccgtcgcggtctacttcgcgctgccgccggcaatcgcggcgaaggcctgtgaggcgctc
gccgcccacgacctgcccgagggcaccgtgctggcgctcgagaagccgttcggcaccgac
cagcccagcgcccacgcactgaacgagcgcctcgccgcgctcgtccccgaggaccgcatc
caccgcgtcgaccacttcctcggccgcgcgacggtgatgaacgtgctcggactacgcttc
gcgaaccggatcctggagccgctgtggtcggccgagcacatcgcgagcgtcgagatcgtc
tacgacgagcagctggccctggagggacgggcgagctactacgacacagcgggcgcgctg
accgacatgatccagagtcatctgctgcaggtgctcgcggtgatcgcgatggagccgccg
tcgacgctcgacgcggccgacctgcgcgatgcgaagtcgatcgtcctgcgcgccacacgc
ctgcacggcgatgacgccgcatcgagctcgcgtcgcgcccggtacacggcggggacgatc
gatgggcgggagctgccgtcctacgcggacgagaagggtgtcgatccggcgcgcacgacc
gagacgctggccgagctcgtcgtcgagatcgacacctggcgctgggcgggcgtgccgttc
acgctccgctccgggaaggcgctcggggagcggcgacgcgaggtggtcatccgcttcaag
ccggtgccgcatctgccccgcggcttccacggcgcggaggagccgtcggtgctgcggttg
ttcctcgcgcccgacaagatggcgctcgaactcagcatcaatggccccggagatccgtac
accctcgagcgcgcctcgctggaggccgtcttcggcgcgggcgagctgctggcgtacggc
gaggtcatctcggggattctcgacgacgatccgtcgctctcggtgcgcggcgacgcggcg
gaggagtgctggcggatcgtgcagccggcgatcgacgcctggcacgccgacgcggtgccg
ctcgacgagtacccggccggcagcgacgggcccgaggggtggccgacggtgtga

DBGET integrated database retrieval system