KEGG   Rathayibacter tritici: A6122_2845Help
Entry
A6122_2845        CDS       T04388                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
rtn  Rathayibacter tritici
Brite
KEGG Orthology (KO) [BR:rtn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A6122_2845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 ABC_export
Motif
Other DBs
NCBI-ProteinID: AND17953
UniProt: A0A160KVY2
Position
complement(3264294..3265508)
Genome map
AA seq 404 aa AA seqDB search
MDPFILLALVVVTALAFDFTNGFHDTANAMATSIATGALKPRTAVALSASLNLVGAFLSI
EVALTVTNAVVKIQDSSGAPDPALLEGGGSALLLIVLAGLIGGIVWNLLTWLLGLPSSSS
HALFGGLIGSALAGLGLNGVNWAGDGTTLDGVVGKVILPALMSPVLAGAVAAIGTWLVFR
VIGNLAEKGLHRGFRIGQIGSASLVSLAHGTNDAQKTMGVITLALIAAGGWSDTESVPFW
VKLSCALAISLGTYIGGWRIIRTVGKGLVEINTPQGMAAESASAAVILASSHLGFALSTT
HVATGSILGSGVGRPGAQVRWRVALRMVIAWVITLPAAALVGAVMWWVGHLVGGAAGGLL
MAAVLVAVASFISIRSRRDSIGAHNVNDEWQDAAARPAPETAGV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggatccctttatcctgctcgcgctcgtcgtcgtcacggccctcgccttcgatttcacc
aatggcttccatgacacggcgaacgcgatggcgacgtccatcgcgaccggtgccctgaag
ccccgaaccgcggtcgccctctcggcgtcgctgaacctcgtcggggcgttcctcagcatc
gaggtggcgctgaccgtcaccaacgccgtcgtgaagatccaggactcctcgggcgcaccc
gacccggcgctgctggagggcggcggatccgctctgctgctgattgtgctggccggcctg
atcggcggcatcgtctggaacctgctcacctggctgctcggcctgccctcgagctcctcg
cacgccctcttcggcggcctgatcggctccgctctcgcgggcctggggctcaacggggtg
aactgggcgggcgacggcaccacgctcgacggcgttgtcggcaaggtgatcctcccggcg
ttgatgtcgcccgtgctcgccggagcggtcgcggcaatcggtacctggctcgtcttccgg
gtgatcgggaacctcgccgagaagggcctgcaccgcggattccgtatcggccagatcggc
agcgcctctctcgtctcacttgcacacggcaccaacgacgcgcagaagacgatgggagtg
atcacgctggcgctgatcgcggccggcggctggagcgacaccgagtcggtcccgttctgg
gtgaagctcagctgcgcgctggccatctcgctcggcacctacatcggcggctggcggatc
atccgcaccgtcggcaagggcctggtcgagatcaacacgccgcagggcatggccgccgag
agcgcctccgccgcggtcatcctcgcctccagccacctcggcttcgcgctctcgaccacg
cacgtcgcgaccggctcgatcctcggctccggagtcggccggcccggcgcccaggtgcgc
tggcgggtggcgctgcgcatggtgatcgcgtgggtcatcaccctgccggccgccgccctc
gtcggcgccgtgatgtggtgggtcgggcacctcgtcggcggcgcggcaggtggtctgctg
atggccgcggtcctcgtcgccgtcgcctccttcatctccatccgctcgcgccgcgacagc
atcggcgcgcacaacgtcaacgacgagtggcaggacgcggcggcacgccccgcgcccgag
accgccggcgtctga

DBGET integrated database retrieval system