KEGG   Ruminococcus torques: RTO_23180Help
Entry
RTO_23180         CDS       T02606                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rto  Ruminococcus torques
Pathway
rto00071  Fatty acid degradation
rto00310  Lysine degradation
rto00362  Benzoate degradation
rto00620  Pyruvate metabolism
rto00630  Glyoxylate and dicarboxylate metabolism
rto00640  Propanoate metabolism
rto00650  Butanoate metabolism
rto00900  Terpenoid backbone biosynthesis
rto01100  Metabolic pathways
rto01110  Biosynthesis of secondary metabolites
rto01120  Microbial metabolism in diverse environments
rto01130  Biosynthesis of antibiotics
rto01200  Carbon metabolism
rto01212  Fatty acid metabolism
rto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RTO_23180
   00630 Glyoxylate and dicarboxylate metabolism
    RTO_23180
   00640 Propanoate metabolism
    RTO_23180
   00650 Butanoate metabolism
    RTO_23180
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RTO_23180
   00072 Synthesis and degradation of ketone bodies
    RTO_23180
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RTO_23180
   00310 Lysine degradation
    RTO_23180
   00380 Tryptophan metabolism
    RTO_23180
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RTO_23180
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RTO_23180
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RTO_23180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rto04147]
    RTO_23180
Enzymes [BR:rto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RTO_23180
Exosome [BR:rto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RTO_23180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CBL26812
UniProt: D4M6F0
Position
complement(2402356..2403537)
Genome map
AA seq 393 aa AA seqDB search
MKEVVVVSGVRLPVGSYGGSLKDITAIDMGAMVVKEAVKRAGIQPSDVDEVVIGQVGEVA
ENGFIARAVSLKAGMPKETTAYSVNRQCGSGLQSIAEAVMEIQTGQADVVVAGGTENISR
LPYYVNDARWGARMGHKVFEDGVIDILTWPLDGNHNGVTAENVAEKYHVTREEQDAFAVR
SHQRACKAIKEGKFKDEILPVELKDRKGNITIFDTDEGPREGQSMEKLAKLRPCFVKGGT
VTAANSSSLNDGAAAVVVMSKEKAEELGVTPKMKIEGYAIAGFDAELMGYSPKFSSEKLA
NKLGVDLKSIDMFEINEAFASQAYAVSRDLGLDPEKVNIYGGGISIGHPIGATGAMLTVK
VMYELMRTDKKDAMISMCIGGGQGISMYFTKCE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtagttgttgtaagtggagtaagacttccagtaggaagctatggtggaagc
ttaaaggatatcacagcaatcgatatgggagctatggtagttaaagaagcagtgaaaaga
gcaggaatccagccatcagatgttgatgaagttgtaattggacaggttggagaagttgca
gagaatggcttcattgcaagagcagtcagtttaaaagctggaatgccaaaagagacaaca
gcatattctgtaaaccgtcagtgtggatcaggacttcagtctattgcagaggctgttatg
gagattcagacaggacaggcagatgttgttgttgcaggtggtacagagaacatttccaga
cttccatattatgtaaatgatgcacgttggggagcaagaatgggacataaggtattcgag
gatggagtgattgatatcctgacatggcctctggatggaaaccacaatggtgtgacagca
gaaaatgtagcagagaaataccatgtaacaagagaagaacaggatgcgttcgcagtacgc
agccatcagagagcatgcaaggcaatcaaagaaggtaaattcaaagatgagattcttcca
gttgaattgaaagatcgtaagggaaatataacaatatttgataccgatgaaggtccaaga
gaaggacagagtatggaaaaacttgcaaaacttcgtccatgttttgtgaaaggcggtaca
gttacagcagcaaattcatccagcttaaacgatggcgcagcagcagttgttgtaatgtct
aaagagaaagcagaagagcttggtgtaacaccaaagatgaaaattgaaggatatgcaatt
gcagggtttgatgcagaattgatgggatattcaccaaagttctctagtgagaaacttgca
aacaaactaggtgttgatttgaagtctattgatatgtttgaaattaatgaagcgtttgca
agccaggcatatgctgtaagtcgtgatcttggattagatccagaaaaagtaaatatatat
ggtggtggaatttccattggacatccgattggagcaacaggagctatgcttactgtaaaa
gtaatgtatgagttgatgagaacagataagaaagatgcaatgatcagtatgtgtattggt
ggtggacagggaatttctatgtactttacaaaatgtgaataa

DBGET integrated database retrieval system