KEGG   Rhincodon typus (whale shark): 109911021Help
Entry
109911021         CDS       T06055                                 

Gene name
wnk1
Definition
(RefSeq) serine/threonine-protein kinase WNK1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtp01001]
    109911021 (wnk1)
   01009 Protein phosphatases and associated proteins [BR:rtp01009]
    109911021 (wnk1)
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109911021 (wnk1)
Protein kinases [BR:rtp01001]
 Serine/threonine kinases: Other
  Wnk family
   109911021 (wnk1)
Protein phosphatases and associated proteins [BR:rtp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109911021 (wnk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 109911021
NCBI-ProteinID: XP_020365847
Position
Unknown
AA seq 2943 aa AA seqDB search
MSENADNVGSLLRPPKNGTNSSSDTTIGERFGVSLRKKEEFKALRRRRHTMDKDSKAEHQ
RFIRRSVICDSNVTALDHLPSKTCIIVSPPESDNAASLISSITINNEAQPPVQATTVDSV
TAAIPVFAGEKCEKCVDGNTKDGSTVAGIGDERPRATVRSLDADVCNHAGTTTSSSKDRK
KQKTVPIKEETELKVNDDDSSESKEAEEAKSQERKAQEDNEEIETKAVATSPDGRFLKFD
IEIGRGSFKTVYKGLDTETTVEVAWCELQDRKLSKSERQRFKEEAEMLKGLQHPNIVRFY
DSWESTLKGKKCIVLVTELMTSGTLKTYLKRFKIMKIKVLRSWCRQILKGLHFLHTRTPP
IIHRDLKCDNIFITGPTGSVKVGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVD
VYAFGMCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNK
DERYAIKDLLSHAFFQEDTGVRVELAEEDDGEKLAIKLWLRIEDIKKLKGKYKDNEAIEF
SFDLERDVPEDVAQEMVESGFVSEGDHKTMAKAIKDRVSLIKRKREQRQLVREKQEKLEE
QQKKHDSLQHQKTQQGASISQTGGGHPSQLSATALPSALTGALPTQVEPEEPEADQHRLQ
YQPAGNSVTSDGTFDSGQSSSGFSDSHGSQTVGYGSAQEPHISSQTPPSIQAASQQHGHQ
HSTGQSPSLVHPCGGVPSQPETVSYPPIPERPFSFSPPPSFSLKVANSQRRKSTSILEAH
THHFQPILRTVGQNAFSADDFTNRNSESSAVKGFVAHRSTSEPIHIEGQVQLEQSQAFEN
KLSLSQLEEKVYPCCMQLQQTSQDPYEVVTCNNLSACAFPLHQSPAEVNLKHQQIYSQPL
GCEESLSGQNLLSCPRQSLIGHVPQIMQMASSKVPAQVSNLASHFPLAQDMMQKHGQHCR
IGEPQAMFPLPTKVFLPVQDGKDAQCEPAMTSIVSRNTVGTMNTMLTVQHLTAPQSAPPI
LTQVNEGRTGSIFEFQVPAVQMEGSGIHVPLPSLTQRVYRNRRASVDLSLEDSQGTGLYS
RLQPVTEEQVVYFSSDALLLPSDFLQSRRPTSEEFAQHLSPQCSSDSGQSTSSETREFQS
PPPFGFLMPFSSLALYCEQQQVLPKHGMHYETLQGVPVSIASQPPMLKQFNTESFPTTSG
TAGLYQQLMEGSWPHPVTFQQNFAVDHSSADGQNLPLQVQMQSQPPPTSLPLTVSNQAAP
QPPPGSMQQTNKFGSYCTLAYLPQTVPQQSVQYSVPQMASSGSVPSQIVPQPQALPISQM
HAAQQGPTSSQNYSSQLPVITPSPVKSSGGVQSTVVSPPLPVSIDVASQPVTQASYHVGL
AAVMAQTYIESTAPGQTRLLQPCTSTVQQSQTGQLQTQASQEGTQAPTQAEQLQLCSSVD
SAHSDVASGMSDGNEGLPTSGRHEGRSAKRHCRKSVRSRSRHEKSSRPKLRILNVSNKGD
RVVECQLETHNRKMVTFKFDLDGDNPVEIAFIMVQNEFILETERESFIDQVREIIEKADE
MLSEDPSGEPEGDQGLETVKAQVAACFNQAQKAEGRYKQEEPLISAPVQLGTQAGSATQV
VHSAGRRFIVSPVPESRLREPTFNVGVTSIKEIQTAGSHSPNLNLSHSASSVSLQQAFSD
LKHKPFQEGPNTAPPIFNQTMAPFTMAHPEMTSIGQGIHIQMAVSSSAPASLITASSASQ
AMVQNIQSQPAELNSESIAGVIGPSSILLPPTSQSAQLSVGGPAAAVSVPSCASPPWTSQ
SGQQLISGHVTSVSVVSSLVPPLTSQVSQALLEETTISVGPSTSVSPSSTEAVILPAPQQ
LNGGSVVSLAESSVSMNLFQSQKENLYSATQAEIHPMDGNIITLAVSTSPPLLPVCGTQS
PVVQTVTSQHAILPQTVGISVPLATQTPIPGTGTAQPVCSIPSVQQTLIHSRPQTAFLPN
QPHIHCSEVDIDLNTKGTGIDNIKTLDEKLRSLFSEHSAAGCAHISASSEMGLVAESTTV
DSLLISGKASAAPGTSTVTVASYPVTATGSVIPPSSLPLGPTGLPLTVQQPLTPASYTVS
LTSVITTAGRPGTPPSKPPLGRLPVQQLSTEALDQQLKQALTPPTEQLPSFPGPSLTQSQ
QPLDTLDAQLRRALSPETVTNVPVPCHISTVVLYLRAVLSLTLGRQRNIPGTLLCKDKGS
GFSRVECSLEPHMTTNQTDSTSELKFYDDYLLKCQEAYLSNTIRMWYKLGTKINQGGTLI
IAQLQYALLGMTPVNGSVVPPGQSYTTTGLPGEGHIPQLGDINTASSEDKLGCPVLVSQS
HEEGVIESNTVVTTATGSGVVKMGRFQVSVATDDVLYQEANDKQQESKLKHMSDESSFSG
SSPESTVIKPEHDSHEDVVDSVSVTQSKNNRSLPYHEHQEQEPAHKANIGRFQVTTRRDT
VGRFSVARTQDEVTYEAGMGVTPYVPLSTAPLTVISSAAVDLFRASDQILPSKESTGSDQ
YVHVNGPVLQETGQQPCSKELDQTQVDSAGSSVSPQSPESKSATIVQNLTNSFNSSYMSS
DNDSEIEDEDMRKELHRLRDKHLKEIQELQSRQKLEIEELYIKLGKAPPAVIIPPAAPLS
GRRRRPTKGKSSKSSRSSSQGQKSPLPSGSLTAQSTASVLTSQQMLLPPPSTQEFTVSGQ
GQLLKPSPSSENLYSAYTSEGVISGQSAPGTAQGSASFHCASEQVTFKLGGRRTRFLSTP
CLALWKMVKKVCPCNQLCRTTSTNAVSGVGSMAQPQQPAITSRKGTFTDDLHKLVDNWAR
DAMNLSQNKRGMKQQGQQGQHYSETMPRKYSAPGQLCVSMTNSAASVGSLGPFSKTPICQ
YGYPGTPYGAQWTGAPPQQQPSIISPTPGLQFQAVGSTSLQSFPLGTLQKSVSNPSGSNL
RTT
NT seq 8832 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaacgcagacaatgttgggtcattattgcgcccccctaaaaatggtaccaat
tctagttcagatacgacaataggggagcgttttggagtaagtttgaggaaaaaagaagag
tttaaggctcttaggaggcggcgacatactatggataaggacagcaaagcagagcaccaa
cgttttatcaggagaagtgtgatctgtgattccaacgttacagcgttggaccatctgccc
agtaagacatgtattatcgtttcgccacccgaatcggataatgcagcttcattaataagc
agtattactattaataacgaagcgcaacctcctgtacaagctacgacagttgactcggtc
actgcggcaattcctgtttttgctggagaaaaatgtgaaaagtgcgttgatggcaatacg
aaggacggaagcacagtcgctggaattggcgatgaacgacctagggctaccgttcgttca
ctcgatgccgatgtctgcaaccacgcagggactacaaccagtagcagcaaagacagaaaa
aaacaaaaaactgttccaattaaagaggaaaccgagttgaaagttaacgatgatgacagt
tcagagagcaaagaagcggaagaggcaaaaagtcaagagaggaaggcacaagaagataat
gaagaaatagagactaaggctgtggcaacctcccctgatgggaggtttttgaagtttgat
atagaaattgggagaggttctttcaaaaccgtctataaaggtctagacacagaaactaca
gtggaagtagcttggtgtgaattgcaggatcgaaagttgtccaagtcagaaaggcaaagg
tttaaagaagaagctgaaatgttaaagggcttgcagcatccaaacatagtcagattttat
gactcttgggaatcaactttaaagggaaagaaatgcatagtattggtgacagagctgatg
acatcgggtactctgaaaacttatttgaagagatttaagataatgaaaatcaaagtgctt
cgaagttggtgtcgtcaaattttgaagggtcttcattttcttcatactcgtacaccaccc
atcatacatcgagatttgaaatgtgacaacatcttcattacaggccctactggatcagtt
aaagttggggatcttggcctagctacactaaaaagggcatcattcgcaaaaagtgtgata
ggtacccctgagttcatggctccagagatgtacgaagaaaaatatgacgagtctgttgat
gtttacgcttttgggatgtgtatgctagagatggcaacctcagaatacccatactcggaa
tgccagaatgctgctcagatctatcgtagagtaaccagtggtgtgaaaccagccagcttt
gacaaggtagcaatccctgaagttaaagaaataattgaaggatgtattcgccagaataaa
gatgaacggtatgcaatcaaggacctattgagccatgccttctttcaggaagatactggt
gttcgtgtagagttggcagaagaagatgatggagaaaagcttgcaattaagctttggcta
cgaattgaagatattaagaaacttaaaggaaagtataaggataatgaagccatagaattc
tcatttgacttggaaagagatgttccggaggatgtggctcaggaaatggtggaatctgga
tttgtatctgaaggagatcacaagaccatggctaaagccattaaagatcgtgtatctctg
atcaaacggaaacgagaacagcgccagttggttagagaaaaacaggaaaagttagaggaa
cagcagaagaagcatgattcattgcagcaccagaaaactcaacaaggagccagtatatct
caaactggagggggacatccttcccaattatctgccacggcacttccttctgcccttact
ggagctctaccaacccaagttgaaccagaagagcctgaagcagatcaacatcgtttgcag
taccagccggctggaaactctgttacatctgatggcacgtttgacagtggccagagttca
tctggattttcagattctcatggcagtcaaactgttggctatggttctgctcaagaaccg
catatttcaagtcagactcctccaagtatccaggcagcatcacaacagcatggccatcag
cattctacagggcagtccccatctctagtgcatccttgtgggggagttccatcacaacca
gagactgtttcatatccacctattcctgaaagaccattttctttctctccaccaccaagt
ttttctctgaaagttgctaattctcaacgccgcaaaagtacttccatcctggaagctcat
actcaccattttcagccaatactaaggactgtaggccaaaatgctttctctgctgatgat
tttacaaatcggaattctgaaagctcagctgttaagggcttcgttgctcatcgatccacc
agtgaaccaatccatattgaaggccaagtgcaactagaacaaagtcaagcctttgaaaac
aagttaagtttgagtcagcttgaggaaaaagtgtatccatgttgtatgcaattacagcaa
acttcacaggatccatatgaagttgtaacttgcaacaacctttcagcttgcgcatttcct
ttgcatcaaagtccagcagaagtaaacctaaagcatcagcagatttattcccagcccttg
ggttgtgaggaatccctgagtggtcaaaatttgttgtcatgcccacgacaaagcctaatc
ggtcatgtgcctcaaataatgcagatggcttcttctaaagtaccagctcaagtttcaaac
ttagcttctcattttccactggcccaagacatgatgcaaaagcatggacagcattgcagg
attggagagccacaggcaatgtttccactgccaactaaagtatttctcccagtacaggat
ggtaaagatgctcaatgtgaacctgcaatgactagcattgtttcaagaaatactgttgga
actatgaatacaatgctaactgttcaacacttgactgcccctcagtctgcaccacctatc
cttacacaggtaaatgagggcagaactggatcaatctttgaatttcaagttcctgcagtg
cagatggaaggtagtggcatccacgttccccttccatcattaactcagagagtttaccga
aatcgaagggcttcagtcgatttaagcttagaggacagtcaagggactggattgtacagc
aggcttcaaccagtgactgaagaacaggtggtttattttagttctgatgctctgttgttg
ccgagtgatttcctgcaaagcagacggcctacgtcagaagaatttgctcagcatcttagt
ccgcagtgttcaagtgactctggtcaatcaacttcctcggagaccagagagttccagtca
ccaccaccttttggattcctgatgccattctccagtttagcattgtattgtgagcaacag
caggttttgccaaaacatggcatgcattatgaaacgttgcaaggtgtgcctgtttcaata
gcttcacaaccacccatgttaaagcagttcaacactgagtcctttccgacaacttcaggg
acagctggcttgtatcagcaactcatggaaggatcctggccccatcctgttacattccag
cagaactttgcagtggatcacagttctgcagatggacagaatctacctttgcaggtgcaa
atgcagagccagccgccacctaccagtcttcctctaactgtgtcaaatcaggcagccccg
caaccacctccaggatccatgcagcagacaaacaagtttggcagttactgcaccctagcg
tatcttccacagacggtaccgcagcagtctgtgcaatattcagttccgcagatggcatcc
agtggctcggttccaagtcaaatagttcctcagccccaagctctgcctatcagtcaaatg
catgctgctcagcagggtcctacttcatcacagaattactcctcccagttgccggttatt
actccaagccctgtaaagtcttctggaggtgtccagtccactgtagtctcacctccactt
ccagtttctatagatgttgcatctcagcctgttacacaagcatcgtatcatgttggtctt
gctgcagtcatggctcaaacctatattgaatctacagcacctggacaaacaagattactc
cagccttgtacctccactgttcagcagagccagacaggacaattacagacacaggcatcc
caagaggggacccaggctccaacgcaggcggaacagttgcagttatgctcatctgtggac
agtgctcactcagatgttgcttctgggatgagtgatggtaatgaaggccttccaacaagt
ggaagacatgaagggcgatcagcaaagcggcattgtcgtaaatctgtgaggagtcgttca
cgtcatgaaaaatcatctagaccaaagctacgaattcttaatgtttcaaataaaggagac
agagttgtggaatgccagttggaaacgcacaatcgaaaaatggttacttttaaatttgat
ttggatggtgacaatccagtagagatagcctttattatggttcagaacgagtttatcctg
gagactgagagagaatcatttattgaccaagtaagggaaattattgagaaagctgatgaa
atgctgagtgaagatccaagtggggagccagaaggtgatcaaggattggagactgtaaaa
gcccaggtagctgcttgctttaatcaagcacagaaagcagaaggcaggtacaaacaagaa
gagccactgatatcagcacctgttcagttaggtacacaggcaggctctgcaacacaagtg
gtccattctgctggaagacggtttattgtgagtcctgtccctgagagccgactacgagaa
ccgactttcaacgtgggtgtcacttcaattaaagaaattcaaacagctggttcccatagt
cccaatctaaacctatcacactcagcttcttcagtgagcttgcaacaagccttttcagat
ttaaagcataaaccgtttcaagaaggtcctaataccgctcctccaatcttcaatcaaact
atggcaccatttactatggcacatccagaaatgaccagtattggacaaggaattcatata
caaatggcggtatcgtcatcagcaccagctagtctcataactgctagttctgcatcccaa
gccatggtacagaatattcaatctcagccagctgagttaaatagtgaaagcattgctggt
gtcattggcccgagttccatattgcttcctccaacctctcagtcagcacagctgtctgtt
ggtggccctgctgctgctgttagtgttccaagttgtgcatctccaccttggacctctcag
tcaggtcagcaactaattagtggtcatgtcacgagtgtttcagttgtaagctcattagtg
ccaccattaacatcacaagttagtcaagctctgcttgaagaaactactatcagtgtagga
ccttcaacgtctgtttccccatcttccactgaagctgtgattttgccagcccctcaacag
cttaatgggggatctgtggtcagcctggcagaatcttcagtttcaatgaacttgtttcag
agccagaaagagaatttgtatagtgcaacccaagcagaaatccatccgatggatggtaat
ataatcacgctggcagtttccacctcaccaccattattgcctgtttgtggcactcaatct
cctgtggttcaaacagttacttcgcaacatgccatcctacctcaaacagtgggcatttct
gtgcccctggcaacccagacccctatacctggcacaggaactgcacagcctgtttgcagt
attccttctgttcaacaaacactgattcacagtcggcctcaaacagcttttcttccaaat
caaccccatattcattgctctgaagtcgacatagatttgaacaccaaaggaacaggcatt
gataatatcaagaccttagatgaaaagcttcgatccttgttcagtgaacatagtgctgca
ggctgtgctcacatttcagcctcttcggagatgggattggttgcagaatctaccacagtt
gatagtttgctcatttcaggaaaagcatctgctgctccagggacttcaacagttaccgtt
gcatcctacccagtaactgccacagggtctgtcatacctccttctagtctacctcttggc
cctacaggacttcctttaactgtccaacaacctttgactcctgccagttataccgtatcc
ttgacgagtgtcattacaactgcagggcggccaggcactccaccttccaagccaccactt
ggcagattaccagtgcaacagctaagcacggaagctcttgatcagcaattaaaacaagct
ctcactccacccactgagcagttgccatcttttccaggaccttcactaacccagtcacaa
caaccgttagacactttggatgcccaattaagacgtgccctgagtccagaaactgtgaca
aatgtaccagttccctgtcacatcagtacagttgttctttacctccgggctgtgcttagc
ctgacgctgggaaggcagcgtaacattccaggcactctgctgtgtaaggacaaaggctca
ggcttttctagagtagagtgctctcttgaaccacacatgacaactaaccaaactgactcc
acttctgaactcaagttttatgacgactacttgttgaagtgtcaagaagcttacttgagc
aatacaataaggatgtggtacaaattaggtacaaaaatcaatcaaggaggaaccctgata
attgcacagcttcagtatgctttgctcggtatgactcctgtaaatgggtcagttgtgcct
cctggacagagctatacaacaactggcctgcctggtgaaggtcatatcccacagctagga
gacattaacacggcttcctcagaagataaattgggctgtcctgtgctagtgtcacagtct
catgaggaaggtgtcatagagtcaaacacagttgtaactaccgcaactggaagtggagtt
gttaaaatgggacgttttcaggtttctgttgcaacagatgatgtcttgtatcaagaagca
aatgataagcagcaagaaagtaagctgaaacatatgtcagatgagtcttccttttctgga
agcagtcctgaaagtacagtgattaaacctgaacatgacagtcatgaagatgtggtggat
agtgtctcagtaactcaaagcaaaaacaacagatctttgccatatcatgaacaccaagaa
caggagccagctcataaggcaaatataggacgattccaggtcacaacacgacgagacact
gttggccgcttttcagtagcaaggacacaggatgaagtgacttatgaagctggcatggga
gtcactccttatgttcctttgagcactgccccattgacggtaatttcctctgcggcagtg
gatctctttagagcttcagatcaaattttaccatcaaaagaatcaactggttcagatcag
tatgtacatgtgaatggaccagttctgcaggagactggacagcaaccttgttcaaaggaa
ctggatcaaacacaggttgatagtgcagggagttcagtttcccctcaatcgccagaatca
aagagtgccaccattgtacagaacctcaccaattcttttaattcctcctacatgagcagt
gataatgattcagaaattgaagatgaagacatgcgaaaagagctccacagattgagggac
aaacatttgaaggagatccaggagttgcagtcaagacagaagctggagatagaggaactc
tatatcaaattgggtaaagcaccaccagctgtaataattccacctgcagcacccctatct
ggacgtcgtagaaggcccactaaagggaaaagcagcaaatctagtcgaagcagttcccaa
ggacaaaagagtcctttaccatctggatccttaactgctcagagtactgcttcagtttta
acatcacagcagatgcttttgccacccccaagtactcaagaattcactgtttctggacaa
ggtcaattgctgaaaccatcaccatctagtgaaaatttgtactctgcttacaccagtgaa
ggggtgatttctggacaaagtgctcctggaactgcacaaggctcagcatcgtttcactgt
gcatcagagcaagtgacttttaaacttggcggcagaaggacaaggtttctgagtacgccc
tgtctggctctttggaagatggtgaaaaaagtctgcccatgcaaccaactgtgtagaaca
accagtacaaatgcagtaagtggagttgggtcgatggctcagccacaacagccagcaata
acgagtagaaaaggcaccttcacggatgatttgcataagctagtggacaattgggctcga
gatgctatgaatctctctcagaacaagcgtggcatgaagcaacaaggtcaacaaggccag
cattactctgaaacgatgccaaggaagtattcggcaccaggtcagctttgtgtctccatg
acaaactctgctgcctcagttggctccttgggccctttcagcaagactcctatctgccag
tatggttatcctggaacgccttatggtgcccagtggactggagcaccacctcaacagcaa
ccaagcattatatcaccaacaccaggtctccagtttcaagcagttggctccacttcacta
cagagttttcccttgggaactttgcagaaatctgtcagcaatccttctggatccaatctt
aggacaacatag

DBGET integrated database retrieval system