KEGG   Rhincodon typus (whale shark): 109912810Help
Entry
109912810         CDS       T06055                                 

Gene name
tpp2
Definition
(RefSeq) tripeptidyl-peptidase 2
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rtp01002]
    109912810 (tpp2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rtp03110]
    109912810 (tpp2)
Enzymes [BR:rtp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     109912810 (tpp2)
Peptidases and inhibitors [BR:rtp01002]
 Serine peptidases
  Family S8: subtilisin family
   109912810 (tpp2)
Chaperones and folding catalysts [BR:rtp03110]
 Intramolecular chaperones
  Subtilisin family
   109912810 (tpp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPPII_N CKS
Motif
Other DBs
NCBI-GeneID: 109912810
NCBI-ProteinID: XP_020367841
Position
Unknown
AA seq 262 aa AA seqDB search
MVSVQYHLIPSPNKQKNGTKEKEVDKEKDAKDEFTDALRDLKIHWMAKLDMNTLYEELKE
SYPTHLPLYVARLHHLDNEKDRIKRIDEIVEAADDVISHIDQTALAIHLAMKTDSRPEAA
ALKSDMEKQKSSLIDALCRKGCALADRLLQLHSQDGAASKEIDNSEDDCKGSFKSLAETF
SEIIKWAELTDAKVLTFAYKHALVNKMYGRALKFAMKLLEDKPTKENWKNCIQIMKSLGW
SHCASFTESWLPVMYPHDYTPF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctgtgcaatatcatcttataccatctccaaataagcaaaagaatggaaccaaa
gaaaaggaagttgataaagagaaagatgcaaaagatgaatttaccgatgctctaagagac
ctgaagatacattggatggccaaattggacatgaatacgctctatgaagaattaaaagag
tcttatcccacacatcttcctttgtacgttgcacgactgcatcatttggacaatgaaaag
gaccgaatcaaaagaatagatgaaattgtggaagcagcagatgacgtcatatctcacatt
gatcaaactgccttagccattcatctagccatgaagacagattccagacctgaagctgct
gctctcaagagtgacatggagaaacaaaaatcctcgctgattgatgctttgtgccgaaag
ggctgtgcactggcagatagacttctgcagctccattcacaggatggtgctgcctcaaaa
gagatagacaattcagaagatgattgcaaaggcagcttcaaaagcttggcggaaactttc
tcggaaataattaagtgggcagaactcactgatgctaaggttttaacttttgcatacaaa
catgcacttgtgaataaaatgtatggccgggccctcaagtttgcaatgaaactgctggag
gataagccaacaaaggaaaactggaaaaattgcattcagataatgaagtctcttggatgg
agccattgtgcatcatttacagagagttggcttccagtaatgtatccacatgactatact
cctttttag

DBGET integrated database retrieval system