KEGG   Rhincodon typus (whale shark): 109915488Help
Entry
109915488         CDS       T06055                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109915488
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rtp04812]
    109915488
   04147 Exosome [BR:rtp04147]
    109915488
Membrane trafficking [BR:rtp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    109915488
Cytoskeleton proteins [BR:rtp04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     109915488
Exosome [BR:rtp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109915488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin Fez1 M Exonuc_VII_L Fmp27_WPPW Peptidase_M3 Gp-FAR-1 Spc7 FapA
Motif
Other DBs
NCBI-GeneID: 109915488
NCBI-ProteinID: XP_020370707
Position
Unknown
AA seq 152 aa AA seqDB search
MLIRTHMQDLKDITNNVHYENYRSRKLAAVTGNGIDASKTKGPLTRSPLAEMEEERREHV
AKMKKMETEMEQVFEMKVKEKKQKLKDSENELQRRHEQMKKNLEAQYKELEEKRKQFEEE
KAAWEMEQRVLEQQRLDSSKTMEKNKKKGKIF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcaggacacacatgcaagatctgaaagatatcaccaacaatgtccactatgag
aattaccggagtcgcaagttggcagcagtgactggcaatgggattgatgccagtaaaacg
aagggacccctcaccaggagtccattggctgaaatggaggaagaacgccgtgagcacgtg
gccaaaatgaagaagatggagacagagatggagcaagtctttgagatgaaggttaaagag
aaaaagcagaaacttaaggactctgaaaatgagctgcaacgtcgtcatgagcagatgaag
aagaatttggaggcacaatataaggaactcgaggagaaacgcaaacagtttgaggaggag
aaagcagcctgggagatggaacagcgtgtgttggagcagcagaggctcgattcatcaaaa
acaatggagaaaaacaaaaagaaaggcaagattttctga

DBGET integrated database retrieval system