KEGG   Rhincodon typus (whale shark): 109916942
Entry
109916942         CDS       T06055                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00230  Purine metabolism
rtp00240  Pyrimidine metabolism
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109916942
   00240 Pyrimidine metabolism
    109916942
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     109916942
SSDB
Motif
Pfam: dNK AAA_28 AAA_29
Other DBs
NCBI-GeneID: 109916942
NCBI-ProteinID: XP_020372292
Position
Unknown
AA seq 172 aa
MSENVFPVPKSHEASWTYSVQTETERLPPALTLLLSAPALAMAVPPSKRSQDQTNGIKPR
KISIEGNIAAGKSTLIQILGEASKDWDVVAEPIARWCNVQTEGDDSEELTTSQKSGGNLL
QMMYDKPERWSFTFQNYASLSRVRSQLKSLSDRVIDSAQPVQFFERSLYSDR
NT seq 519 nt   +upstreamnt  +downstreamnt
atgagtgagaatgtgtttcctgtccctaaatctcatgaagccagctggacgtattcagtt
cagacagagacggagaggttaccaccagctctcacactcttgctttcagctccagccctg
gccatggcagttcccccaagtaaaaggagccaagatcagaccaacggcatcaagcctcgg
aaaatttcaatcgaggggaatattgctgctggcaaatcgacgttgatccagattttggga
gaagccagtaaggattgggatgtagttgctgagcccatcgctcgttggtgtaatgtgcaa
acagagggagatgattctgaggagctaacaacatcgcaaaagagtggagggaacctgctg
cagatgatgtacgacaaaccagaacgctggtccttcacctttcagaactacgcctcttta
agcagagtacggtcacagctcaaatccctcagcgacagagtgatagactcagcccagcca
gttcagttctttgagcgctctctgtacagtgacaggtaa

DBGET integrated database retrieval system