KEGG   Rhincodon typus (whale shark): 109917406Help
Entry
109917406         CDS       T06055                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04270  Vascular smooth muscle contraction
rtp04350  TGF-beta signaling pathway
rtp04510  Focal adhesion
rtp04530  Tight junction
rtp04810  Regulation of actin cytoskeleton
rtp05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109917406
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109917406
   04530 Tight junction
    109917406
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109917406
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109917406
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109917406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtp01001]
    109917406
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rtp03036]
    109917406
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109917406
Protein kinases [BR:rtp01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   109917406
Chromosome and associated proteins [BR:rtp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    109917406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase APH Seadorna_VP7 Pkinase_fungal Kdo RIO1
Motif
Other DBs
NCBI-GeneID: 109917406
NCBI-ProteinID: XP_020372814
Position
Unknown
AA seq 356 aa AA seqDB search
MSSGDSLEARFEKIEFMLKDPKCEVNSECLLDSLDALIYDLDFPALRKNKNIDSFINRYK
DAMSKVRDLRMKAEDYEVVKVIGRGAFGEVQLVRHRGTRKVFAMKLLSKFEMIKRSDSAF
FWEERGIMAFANSPWVVQLSYAFQDNRYLYMVMEYMPGGDLVNLMSNYDMPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
EDSEISKDAKSLICAFLTDRYKTTGGVTSVFCCTVSFDFRLFCTHRQTKLLGYPSS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctggggatagtttggaagctcgatttgaaaaaatcgaatttatgttaaaggat
cccaagtgcgaagtgaatagtgaatgtttgctggatagcttggatgccttaatttatgat
ttggactttcctgccttaagaaaaaacaagaacattgacagcttcataaatcgatacaaa
gatgcaatgagtaaagttcgggatttaagaatgaaagcagaagactatgaagttgttaaa
gtgattgggagaggagcatttggtgaagttcagctggtgagacacagaggcacaagaaaa
gtatttgcaatgaaactactcagcaagtttgagatgattaagcgatctgattcagcattc
ttttgggaagagaggggcatcatggcttttgctaatagtccatgggtagtacagctatcc
tatgcattccaagataaccgctacctctacatggtgatggagtatatgcctggtggggat
ctcgtaaatttaatgagtaattatgatatgcctgaaaaatgggccagattttatacagca
gaagttgtacttgccctggatgccattcattctatgggtttcattcacagagatgtgaag
ccagataatatgttgcttgacaaagctggtcacttaaaattggcagattttggaacttgc
atgaagatgaataaagaagggatggtacggtgtgatactgcagtggggactccggactat
atttcacctgaggtgctgaaatctcaaggaggagatggttattatgggagagagtgtgat
tggtggtcagttggagtattcctgtatgaaatgcttgtcggtgacacacccttttatgca
gactcactagttggaacttatagcaaaatcatgaatcacaaaaactcactgacatttcct
gaggacagtgaaatatccaaggatgcaaaaagcctcatttgtgcattcctcactgacagg
tataaaacaacaggtggagttactagtgtcttctgttgtaccgtgtcctttgactttcgt
ttgttttgtactcatcggcagacaaaacttcttgggtatccgtcgtcg

DBGET integrated database retrieval system