KEGG   Rhincodon typus (whale shark): 109918144Help
Entry
109918144         CDS       T06055                                 

Gene name
mapkapk2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04010  MAPK signaling pathway
rtp04218  Cellular senescence
rtp04370  VEGF signaling pathway
rtp04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109918144 (mapkapk2)
   04370 VEGF signaling pathway
    109918144 (mapkapk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109918144 (mapkapk2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109918144 (mapkapk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rtp01001]
    109918144 (mapkapk2)
Enzymes [BR:rtp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109918144 (mapkapk2)
Protein kinases [BR:rtp01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   109918144 (mapkapk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 109918144
NCBI-ProteinID: XP_020373664
Position
Unknown
AA seq 210 aa AA seqDB search
PENLLYTTKRPNAILKLTDFGFAKENHQLQFISNPCYHHIIAPEVLGPEKYDKSCDMWSL
GVIMYILLCGYPPFYSNHGLAISPGMKKRIRMGQYEFPNPEWSEVSEEAKQLIRQLLKTE
PTQRMTIMEFMNHPWINQSMQVPQTPLHTSRVLKEEKDLWEDVKEEMTSALATMRVDYEQ
IKIKKIEESCNPLLIKRRKKALTAPTPASH
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
ccagaaaatttgttgtacaccaccaaaagacctaatgctattctaaaactaacagatttt
ggctttgccaaagaaaaccaccagcttcaattcattagcaacccttgctaccaccatatt
attgcccctgaggttcttgggcccgagaagtatgacaaatcctgcgatatgtggtccttg
ggtgtaataatgtacatactgttgtgtggatatcccccattctattctaaccatggactg
gccatttcacctggcatgaagaaacgaatccgaatgggccagtatgaattccctaatcca
gaatggtcagaagtatccgaggaagccaaacaactgatcagacaactcctgaagactgag
ccaacacaacgcatgaccatcatggaatttatgaaccatccttggattaatcaatcaatg
caggtaccgcagacacctcttcataccagtagggtcctgaaagaagagaaagatttatgg
gaagatgtaaaggaggaaatgaccagtgccttggcaaccatgagagttgactacgaacaa
atcaaaatcaaaaagatagaagaatcttgcaatcccttactgataaaaagaagaaagaag
gccttaactgctccgactccagccagccactga

DBGET integrated database retrieval system