KEGG   Rhincodon typus (whale shark): 109918287Help
Entry
109918287         CDS       T06055                                 

Definition
(RefSeq) dedicator of cytokinesis protein 8-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rtp04131]
    109918287
Membrane trafficking [BR:rtp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    109918287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398 DOCK-C2 DOCK_N
Motif
Other DBs
NCBI-GeneID: 109918287
NCBI-ProteinID: XP_020373781
Position
Unknown
AA seq 541 aa AA seqDB search
MQPPFYEPAVPVDFEEFLMSQLNIVDPDLQQDLGDFPDDDLEITFIPRECRTVQPSVPEE
GIDLDPLVRDCVQTYTQDWLIVNRRNQGEIGTLSSSRLELRRDLCKSLPKQLFESEDGGN
TVSQEDDATPSLVLCDQSGRTTLTSCDFDLRSLQPDTRLENALQPITPEGLDKQNEETRK
ANRQSELFALYPPIDEEDAVEIRPIPDCPKEHMGHRIHVKCQILKFEIEVEPLFASLALY
DLKEKKKISENFYCDLNTEQIKAFLRSHTNQMAPSSLSRSAIFSITYPSPDIYLVIKIEK
VLQQGDIAECAEPYLVMKESESAKNKDKIEKLKSQAENFCQRLGKYRMPFAWAYINIMNV
VSTASDRDSMEVEHINGKGNSGDKKVFTQQRRLSERSAFLEDQYNLSNFKAATITINNFF
KQEGDRLSDEDLLKFLAELKRSSASLRRLRPISGLIKLEISPAAENPTCCITPELLPVKP
FPENRTRPIKEILEFPAREVYVPHTSYRNLLYVYPQRLNFGNRLASARNITVKIQFLADE
D
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctccattttatgagcctgcggtgccagtggattttgaggagttcctgatgtca
cagctcaacattgtagatcctgaccttcagcaagatctgggagacttccctgacgatgac
ctggagattacatttattccaagagaatgcagaacagtgcagccttcagtccctgaagaa
ggaattgatttagatccacttgtgcgagactgtgtccagacctacactcaggattggctt
attgtcaacagaaggaaccaaggagaaattgggaccttgagttcaagcagacttgaattg
aggagggatctgtgcaagagtcttccaaagcagttgtttgaatctgaagacggtggcaat
acagtcagtcaagaggatgatgcaacgccttctctggttctgtgtgatcagtctgggagg
acaacattgacatcctgtgactttgaccttcgcagcctgcagccagatacccgtttagaa
aatgcacttcagcctattactccagagggactcgataaacaaaatgaagaaacacgcaaa
gccaacaggcagtcggaattatttgcactctatccaccaatagatgaggaggatgctgtg
gaaattcgcccaattcctgactgtccgaaagagcatatgggccacaggatccacgtaaag
tgccaaatcttaaagtttgaaattgaagtggagccactctttgccagcttagccttgtat
gatttaaaagagaagaaaaagatttcagaaaatttctactgtgatttgaacactgaacag
atcaaggcctttcttcgttctcacacaaaccaaatggcgccatccagtctgagtaggtca
gccatcttctccatcacctacccatctccagatatctacctggtcattaagattgagaaa
gtccttcagcagggagatattgcagaatgtgctgaaccatatcttgtaatgaaagaatct
gagtcagcaaagaataaagacaaaattgagaaacttaagtctcaagcagagaacttttgc
cagcgattgggaaaataccgcatgccatttgcctgggcttacataaacatcatgaatgtg
gtctcgacagcatcagacagggattcaatggaggttgaacacatcaatggtaaaggaaac
agtggagacaagaaagttttcacacaacaaagaagactttctgagaggtcagcttttctg
gaggatcagtataatctgtccaatttcaaagcagccacaattaccatcaataatttcttt
aaacaggaaggtgacagactaagtgatgaagatttgctcaagtttttagctgaactgaaa
aggtcttctgcatcattaaggagattgcggccaatatcaggtttaatcaagcttgaaatt
tcaccagctgcagagaaccccacatgctgtattacacctgaacttttacctgtgaaacca
tttcccgaaaatcgcacccgaccgattaaagaaatccttgaattcccggctcgagaagtc
tatgttcctcatacatcgtacaggaatctactttatgtctatccacagaggcttaatttt
ggcaaccggttagcctctgctagaaatatcacagtcaaaatccagttcttggcagatgag
gattga

DBGET integrated database retrieval system