KEGG   Rhincodon typus (whale shark): 109919705Help
Entry
109919705         CDS       T06055                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 2',3'-cyclic-nucleotide 3'-phosphodiesterase-like
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rtp04147]
    109919705
Enzymes [BR:rtp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     109919705
Exosome [BR:rtp04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   109919705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase AAA_22 AAA_18 AAA_30 Nsp2a_N AAA_17
Motif
Other DBs
NCBI-GeneID: 109919705
NCBI-ProteinID: XP_020375326
Position
Unknown
AA seq 200 aa AA seqDB search
MGAKHSKVIGNFPFLNDNGTIETIKEAHTXFVLRGLPGSGKSILGKAIKEKYPQSLACAS
KFPPVADEAETDCDRYAQVDEGLEWGFKEIKNVIVVDDNHLAAKRLDHLTSLARDNDYIV
LIVSPKTEWRNDCEKLATQSQWKLTVEQLNSMKQSYQEYIIPYFFGWFLLRRSAQEMRKN
AEDFLKQLSEMEVFLKEFVA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgaaacactctaaggtcattggtaacttcccattccttaatgacaatggcacc
atcgagacaattaaggaagcccacaccntcttcgttctacgtggtctgccaggcagtggc
aagtcaatccttggcaaagcaatcaaagaaaagtacccgcagtccttggcttgcgcttcc
aagtttcctcctgtggcggatgaggccgagactgactgtgatcggtacgcccaggtggac
gagggtctcgaatggggcttcaaggagatcaaaaatgtcatagtggtcgatgacaaccat
cttgctgcaaaacggctggaccacctcaccagcctggccagagacaacgactacattgtc
ctcattgtcagcccaaaaaccgagtggagaaatgactgcgagaagcttgcgactcagagc
cagtggaaactaactgtggaacaactgaacagcatgaagcaaagctatcaggagtacatc
ataccctatttctttggctggttcttgctgaggaggagtgcccaggagatgcgcaagaat
gcagaggattttctgaagcagctgagcgaaatggaggtgtttttaaaagagtttgttgct

DBGET integrated database retrieval system