KEGG   Rhincodon typus (whale shark): 109921237Help
Entry
109921237         CDS       T06055                                 

Gene name
adh5
Definition
(RefSeq) alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00010  Glycolysis / Gluconeogenesis
rtp00071  Fatty acid degradation
rtp00350  Tyrosine metabolism
rtp00830  Retinol metabolism
rtp00980  Metabolism of xenobiotics by cytochrome P450
rtp00982  Drug metabolism - cytochrome P450
rtp01100  Metabolic pathways
rtp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109921237 (adh5)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109921237 (adh5)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109921237 (adh5)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    109921237 (adh5)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109921237 (adh5)
   00982 Drug metabolism - cytochrome P450
    109921237 (adh5)
Enzymes [BR:rtp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     109921237 (adh5)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     109921237 (adh5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N Pep_deformylase
Motif
Other DBs
NCBI-GeneID: 109921237
NCBI-ProteinID: XP_020376859
Position
Unknown
AA seq 377 aa AA seqDB search
MAGTEGKVIKCKAAVAWEAGKPLSIEEVEVAPPKAHEVRIKIIATGVCHTDAYTLSGSDP
EGVFPVILGHEGAGIVESVGEGVTRVKAGDRVIPLYVPQCGECKFCLNPNTNLCQKIRVT
QGQGLMPDKTSRFTCKGQLVYHYAGTSTFSEYTVVADISLAKVDSAAPLDKVCLLGCGIS
TGYGAVVNTAKVQPGSTCAVFGLGGVGLAAIMGCKVAGATRIIAVDLNKDKFAKAKEFGA
TEFVNPKDYEKPIQEALVELTDGGVDYSFECIGNVKTMRAALEACHKGWGTSVIIGVAPA
GHEIATRPFQLVTGRTWKGTAFGGWKSVESVPKLVQEYMAKKIKVDEFVTHTLPFDQINE
AFELMRSGKSIRSVLLF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggggactgagggcaaggttatcaaatgtaaagctgctgttgcctgggaagcagga
aaacctcttagtattgaggaagtggaagttgcacctccaaaagctcatgaagttcgaatt
aagattattgccactggtgtctgccacactgatgcctacaccttgagtggctcagatcca
gaaggagttttccctgttatccttggacatgaaggagctgggatagtggaaagcgttgga
gagggagtgacccgtgtcaaagcaggggatcgagtaattccactttacgtcccacaatgt
ggggagtgcaagttttgcctgaaccccaacaccaatctctgccagaagatcagggtgacc
cagggccagggtctgatgcctgataagaccagccgatttacctgtaagggccaactggtt
taccactacgcagggactagcaccttctctgaatacactgtcgttgcagacatctcgctg
gctaaagtcgacagtgcagctccactggataaggtttgcctgttgggctgtggtatttcc
actggatatggtgcagttgtcaatacggccaaggttcaaccaggctctacctgtgctgtg
tttggactgggaggagtgggtttggcagccattatgggatgtaaagttgctggtgccact
cggatcattgcggttgacctcaacaaagacaagtttgcaaaggctaaagagtttggtgca
actgaattcgtcaaccctaaggattatgaaaaacccattcaagaagctttggttgaatta
acagatggtggagtggactattcctttgagtgtattggtaatgtcaagaccatgagagct
gcccttgaagcatgccacaagggttggggaaccagtgtgataattggggtggcacctgct
ggacacgaaattgcaactcggcccttccagttggtgactggtcgtacgtggaaaggaaca
gcatttggagggtggaagagtgtggagagtgtgccaaagcttgtgcaagaatacatggct
aaaaaaataaaggtggatgagtttgtgactcatacactcccttttgaccagatcaatgag
gcttttgagctgatgcgcagtggaaagagcattcgaagtgtcctcttgttttga

DBGET integrated database retrieval system