KEGG   Rhincodon typus (whale shark): 109921394Help
Entry
109921394         CDS       T06055                                 

Gene name
mrpl22
Definition
(RefSeq) LOW QUALITY PROTEIN: 39S ribosomal protein L22, mitochondrial
  KO
K02890  large subunit ribosomal protein L22
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    109921394 (mrpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rtp03011]
    109921394 (mrpl22)
Ribosome [BR:rtp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    109921394 (mrpl22)
  Bacteria
    109921394 (mrpl22)
  Archaea
    109921394 (mrpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 DUF2461
Motif
Other DBs
NCBI-GeneID: 109921394
NCBI-ProteinID: XP_020377024
Position
Unknown
AA seq 220 aa AA seqDB search
SSVSAVLLPPHPPSLSVFCLVGAAFIRSLLTHIHSRLLASCSLVAQSHIHSSLPLPAKNW
ERKNRVVYPPQLPDEPRRPVEVYHCRRQIKYSKDKMWYLAKMIRGMTFDQAVAQLQFNDK
KGAKVMLEVLLEAQEMAVRNHNLEYRSNLYVAESFSSKGQYLKRIRYHGRGMFGIMDKVY
CHYFVKLVEGSPPLKKATTGFDQAKEYVQQLRNRTIIHSL
NT seq 664 nt NT seq  +upstreamnt  +downstreamnt
cagctcagtgagtgcagtgttgcttcctcctcaccctccctcactctctgttttctgtct
tgtaggtgctgcatttatcaggagtttgctgacccacattcacagcagattgctcgcatc
atgcagccttgttgctcagtcccacatacacagcagcctccctctacctgccaagaactg
ggagaggaagaaccgagtggtttaccctccgcagctgccagatgagcctcgcagacccgt
ggaagtttaccactgcaggagacaaatcaaatacagcaaggataaaatgtggtatctggc
aaaaatgatcagagggatgacgttcgaccaagcggttgcccagctgcagttcaatgacaa
aaagggagcgaaggttatgttggaggttcttctggaagcccaagaaatggctgtcaggaa
ccacaatctggagtacagatcgaacctatacgtagctgagtcattctcaagtaagggtca
gtatctgaagaggattcgctaccatgggcgagggatgtttggcatcatggacaaagtcta
ctgccactactttgtcaagctggtggaaggaagccccccgctgaagaaggcaacaaccgg
ctttgaccaggccaaggagtatgtgcagcaactgcgtaacagaaccatcattcactccct
gtaa

DBGET integrated database retrieval system