KEGG   Rhincodon typus (whale shark): 109921757Help
Entry
109921757         CDS       T06055                                 

Gene name
phf6
Definition
(RefSeq) PHD finger protein 6 isoform X1
  KO
K23310  PHD finger protein 6
Organism
rtp  Rhincodon typus (whale shark)
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rtp03000]
    109921757 (phf6)
   03009 Ribosome biogenesis [BR:rtp03009]
    109921757 (phf6)
   03036 Chromosome and associated proteins [BR:rtp03036]
    109921757 (phf6)
Transcription factors [BR:rtp03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    109921757 (phf6)
Ribosome biogenesis [BR:rtp03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   109921757 (phf6)
Chromosome and associated proteins [BR:rtp03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    109921757 (phf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 109921757
NCBI-ProteinID: XP_020377393
Position
Unknown
AA seq 363 aa AA seqDB search
MATDSKGKRRGSRQPKCAFCKLNKEEHCGQLLVAQSQKMAAHHKCMLFSSALVTSHSENE
TLGGFLLEDIKKEIKRGNKLSCSCCHRPGATIGCDVKTCRRTYHYYCAKLDKAQIKEDAS
QGIYLILCQKHKEGAEDSSEDGFQGNLSERSTGPRKGTPRAHREKRRAPNSKDESDDALS
TSSQGKDETSCSSYRERSPHCSSPTITGPKCGFCHAGDEENETRGKLHTSNAKKVAAHYK
CMLFSSGTVQLTNSSRKDFGDFDIKTVIQEIKRGKRMKCTLCSQIGATIGCEIKACIKTY
HYHCAVEDRAKFIENLDRGIYRLYCKNHSGNDDRDEEDEERESISRYGKEQEADRNREVL
EEV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgattctaaggggaagaggagggggtcgagacaaccgaaatgtgctttctgt
aaactcaataaagaggagcattgtggccagttgttagtagcccaaagccagaagatggca
gcacatcacaaatgtatgttattttcatctgctctagtgacatcgcattctgagaatgag
actctcggaggcttcttgcttgaagatatcaagaaggaaataaaaaggggaaacaagttg
agctgctcttgctgtcaccgcccaggagcaactattggatgtgatgtgaaaacttgtcgg
agaacatatcattattattgtgcaaagcttgataaagcccagatcaaggaagatgcatca
cagggcatatatctgatcctctgtcagaagcacaaagaaggtgccgaggattccagtgaa
gatggatttcaaggaaacctgagtgagcgttccacaggtcctcgcaaaggcactccgaga
gcacacagagaaaaacggagagctccaaactcgaaagatgagtcagatgatgctctgtcc
acatcctctcaagggaaagatgaaaccagttgcagttcttacagggaacggtctcctcac
tgcagtagtcccacaattacagggccgaaatgtgggttttgtcatgctggagatgaagaa
aatgaaaccagaggaaaactccacacgtcaaatgctaaaaaggttgccgcacattacaaa
tgcatgctgttttcttctggtactgtccaactcacaaattcatctagaaaagattttggt
gattttgatattaaaacagtcattcaagaaatcaagagaggaaaaagaatgaaatgtaca
ttatgcagtcaaataggcgcaacgattgggtgtgaaataaaggcttgcatcaagacttac
cattaccactgtgctgttgaagatcgagccaaattcattgagaatcttgaccgagggatc
tacaggctgtactgtaaaaaccacagtgggaacgatgaccgagatgaggaggatgaagaa
agagaaagcatctcacgctatggcaaagagcaagaagctgaccgtaatcgtgaggtctta
gaagaggtatag

DBGET integrated database retrieval system