KEGG   Rhincodon typus (whale shark): 109923023Help
Entry
109923023         CDS       T06055                                 

Gene name
eif3a
Definition
(RefSeq) LOW QUALITY PROTEIN: eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp03013  RNA transport
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109923023 (eif3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:rtp03012]
    109923023 (eif3a)
Translation factors [BR:rtp03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    109923023 (eif3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 109923023
NCBI-ProteinID: XP_020378658
Position
Unknown
AA seq 1172 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVIKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKGESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSKVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRTHLGQIQRHHNQSTAINLNNPDSQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLSPEEMQRMSTRVLLATLSIPITPERTDIARLLDMDGIIVEKHRRLATLLG
LQAPPTRQSLINDMVRFNVMQYAAAEVKGVYNWLEVEFHPLKLCGRVTKVLNWVRDQSEK
EPDLQHYVPHLQNNTILRLLQQVAQIYQSIEFTRLASLVPFVDAFQLERAIVDAARHCDL
QVRINHSSRTLSFGSDLNYSPREDSPVGPYLQPMPSEQIRSQLTAMSAALAKAIQVVKPT
HLLHEKEEQHQQAVSAYLKNARKEHQRILARRQTIEERKERLESLNVQREKEEMELREAE
LQKVRKAEEERLRQEAQEREKERLMQEHENIKRKHVRERLEQIKKTELGAKAFRDIDIEN
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDFFERAKRLEEIPLLKKAFEEQRIK
DMELWELQEEERITSMKVEREKALEHKNRMSRMMDDQDLFLTKLMASRRTVYEEKLKNFQ
DRLNAERKMRLEERKKQRKEERRRIYYIQKEEEAQRLEEEKLKKEREEKERCEREKREAE
EREYQEKLRKLEETERKRRQREMEIEERERRKEEERKYAEDQFRRKESQRWSDRDSERDS
WRDSRIIDRDSEWRRGGTDAEWRRGESRGFDDDRPAFRRGEDRIRRDDDREPLFRRGDDD
RGPLFRRGDDDRGSWRDDDRGPRRVDDSRPGPWRPLDKPGGGWREREKAREESWAPPRDT
RSSEDNRDRDLDRDQDRDRRIAFRDKDDGPWRRGGGSEESSWREAPRRDDRDGDRDRRDF
RERRDIKSRKDEPERRAAPIRSDRDDGTWRRGGEDRHGESQANQEAQDTAMKGPPLKDSD
QEKSTWRTDKDKEAPRRIKNVIDEEGWTTVRR
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgtattttcagagacctgagaacgctctgaaaagagccaatgaattcttggag
gttggcaaaaaacaacctgctcttgatgtgttgtatgatgttattaaaagcaaaaaacat
cgaacatggcagaaaatacacgagccaattatgctcaaatacctggagctgtgtgtggat
cttcgcaagagccacttagcaaaggaagggttgtatcagtacaagaacatctgtcagcag
gtaaatatcaagtccttggaggatgtggttagagcttatcttaagttagctgaggaaaag
actgaagctgctaaaggagagtctcagcagatggtacttgatattgaagacttggacaat
attcaaactccagagagtgtgctgcttagtgctgttagtggtgaggacacccaagatcgt
acagatcgtctgctgctaactccatgggttaaatttctttgggagtcttacagacaatgt
ttggatttattacgtaacaactctaaagtggagcgcctttatcatgacattgctcaacaa
gcttttaagttctgcttgcagtacacccgaaaagcagaattccgcaaattatgtgacaac
ctgcgtacacacttgggacagatccagcgtcaccacaaccaaagcacagcaatcaacctt
aataatcctgatagccagtccatgcacttggagactcgccttgtacaacttgatagtgca
attagtatggaactttggcaggaagctttcaaggcagtagaagatattcatgggctattt
tctttatccaagaagccccccaaaccccagctgatggctaactactataataaagtttcc
acagtattctggaaatcgggaaatgctctgtttcatgcatccactcttcaccgactatac
catttgtccagagagatgagaaaaaatctttcaccagaggagatgcagaggatgtctacc
agagtgcttttagctacactgtcaattcctataactcctgaaaggacagacattgcccga
ttgctcgacatggatggtattattgttgagaagcaccgacgattagctacactgttggga
ttacaggcacctccaactcgacaaagtttaattaatgacatggttcgtttcaatgtgatg
cagtatgctgcagctgaagtgaagggggtgtataattggttagaagtagaatttcacccg
ctgaaactttgtggacgcgttactaaggtcctcaactgggtccgagaccagtcagaaaaa
gaacctgaccttcagcattatgtacctcatttgcagaataataccatccttcggctcctt
caacaggtagctcagatttatcaaagtatagagtttactcgtttggcttccttggttcca
tttgttgatgcctttcagctggaacgtgccattgttgatgctgccagacactgtgatttg
caggttcgcatcaatcattcttctcgtactttaagttttggctcagatctcaactattct
ccacgagaagattcgccagtgggtccttacttgcagccaatgccttcagagcagatcaga
agtcagttgactgctatgtctgctgcattagcgaaggctatccaagttgtcaagccaaca
catttgcttcatgaaaaggaagagcaacaccagcaagctgtcagtgcttatttgaagaat
gctagaaaggaacatcagcggatccttgcccgtcgccagactattgaggagagaaaggaa
cgcctggaaagcctgaatgttcagcgggaaaaagaggaaatggagttgcgagaggcggaa
cttcagaaagttcgcaaggctgaagaagagcgtttacgtcaagaggcacaagagagagaa
aaagaacgtcttatgcaggagcatgaaaacatcaaacggaaacatgtgcgagaacgcctg
gagcagattaaaaaaactgaactgggagctaaagcatttcgagatattgacattgagaac
cttgaagaactggatccagattttatcatggctaagcaggttgagcagttggagaaagaa
aagaaggaacttcaagaacgtctgaaaaatcaggaaaagaagattgacttctttgaaaga
gccaagcgattggaagaaatacctttactcaaaaaagcatttgaagaacagcgaataaag
gatatggaattgtgggaacttcaagaggaggaaaggattaccagtatgaaagttgagcgt
gagaaagccctggagcataagaatcgaatgtcaagaatgatggacgatcaagacctgttc
ctaacaaagcttatggcttcacgtcgtactgtttacgaggagaaactaaagaacttccaa
gacaggctcaatgcagaacggaaaatgcgtttagaggagcgtaagaaacaacgcaaagaa
gaaagacgcagaatctactacatacaaaaagaggaggaagctcagagattggaggaagaa
aaacttaaaaaagagcgtgaagaaaaggagcgctgtgagcgtgaaaaacgagaagcagaa
gagcgtgaataccaggaaaaactaagaaaattggaggaaactgaaaggaaacgacgccag
cgagaaatggaaattgaagaacgcgagcgtcgtaaagaagaagaaaggaaatatgctgaa
gaccagtttcgccggaaggaatctcagcgctggagtgacagagactctgaacgagatagt
tggagggattcccgtattatagacagggattctgaatggagacgcggaggaactgatgcc
gagtggcgccgaggggaaagccgtggctttgatgatgataggccggcattccgccgtggg
gaggaccgaattagacgggatgatgatagagagccattgtttagaagaggagatgatgat
cggggtccgctattcaggcgaggtgatgatgacagggggtcttggcgggatgatgatcga
ggcccccgccgtgtggatgattcgaggcctggcccgtggagaccacttgataaaccaggt
ggcggatggagagaaagggaaaaagcacgtgaagaaagctgggccccacccagagacact
agatcttccgaagataacagagatcgtgatttggatagagatcaagatcgtgatcgccgt
attgcatttagagacaaagatgatggcccttggagacgtggtggtggctcagaagagtct
agctggagagaagctccacgacgtgatgaccgggatggtgatcgagatcgtagagatttt
cgcgaacgtcgagacatcaagagtcgtaaagatgaaccagagcgtcgtgctgcacctatt
cgaagtgatcgagatgatggtacctggcgacgtggcggtgaagatcgccatggtgaaagc
caagctaaccaagaggcacaggatactgccatgaaaggtccaccacttaaggacagtgac
caagaaaaatcaacttggagaactgacaaggacaaagaggcacctcgtcgtatcaaaaat
gtcattgatgaagaaggctggactactgttcgccgctaa

DBGET integrated database retrieval system