KEGG   Rhincodon typus (whale shark): 109923912Help
Entry
109923912         CDS       T06055                                 

Definition
(RefSeq) arylamine N-acetyltransferase 2-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp00232  Caffeine metabolism
rtp00983  Drug metabolism - other enzymes
rtp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    109923912
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    109923912
Enzymes [BR:rtp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     109923912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 109923912
NCBI-ProteinID: XP_020379530
Position
Unknown
AA seq 291 aa AA seqDB search
MKLSEYFARIGYTGPCNKADLETLGRIVENHLTSIPYENLSPHCGETIEVNVEAIFDKVV
RKHRGGCCVEHNGLFWWVLKEMGYKVMFIAARLYKPAKDCYESYPSHCILIVTIDSKSYV
VDVGFVSSYQPRQPLELVSGKEQSQLPGTYRLTEDNNIWYMDKAVRKLHIEGQSNNSESL
QNHPAYQKLFCFALKPCKIEDFQDKLTYLITTPGAMFKELSYVCYQTQNGIKILKGTTYI
ERIFNGKDGTDVRTSKTLTEEELQHVLKETFNLMLDKKIMHVNNFTHFLIE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttctgaatattttgcacgaattggctacacaggaccttgcaacaaagctgac
ctggagacactaggcagaatagttgaaaaccatctcacatctattccctatgaaaatctc
agtccacactgtggagaaacaattgaggtcaatgtggaagcaatctttgataaagtggtg
aggaagcatcgaggtggctgctgtgtggaacataatggcttattctggtgggtactaaag
gagatggggtacaaagtgatgtttatagctgcaagattgtacaaaccagcaaaggattgt
tacgaatcctacccatctcattgtatcctcatagtcaccattgattctaagagttatgtt
gttgacgtgggctttgtatcatcctaccaaccacgacaaccactggagctggtatcaggc
aaagaacagtctcagcttccgggcacataccgcctgactgaagacaacaatatctggtac
atggataaagctgtaaggaaacttcacattgaaggtcaaagcaacaacagtgagtctctg
cagaaccatcctgcctaccaaaaactgttttgttttgcccttaagccttgtaaaattgag
gattttcaggacaaattaacctatttaataacaactcctggggccatgtttaaagaatta
tcctatgtttgttatcaaacccagaatggcattaaaattctgaagggtacaacctacatt
gaaaggatctttaatgggaaagatggaacagatgtgagaacctccaaaacgctgactgaa
gaagaattacaacatgtactcaaggagacattcaacttgatgttggacaagaagataatg
catgtgaataacttcactcatttcctgattgaataa

DBGET integrated database retrieval system