KEGG   Rhincodon typus (whale shark): 109924754Help
Entry
109924754         CDS       T06055                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
rtp  Rhincodon typus (whale shark)
Pathway
rtp04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rtp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109924754
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rtp04030]
    109924754
G protein-coupled receptors [BR:rtp04030]
 Rhodopsin family
  Lipid
   Leukotriene
    109924754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 109924754
NCBI-ProteinID: XP_020380335
Position
Unknown
AA seq 330 aa AA seqDB search
MVFSNATADHTSVPVQNAVACVVLGLACLVGVPGNFTVIVTVLCNIKQRSSTIVLILSLA
VADFVVLVTLPFWIYFLADSWIFGILLWKLTVYLIFTSMYASVFFIALLSVERLVAVLYP
FLIQKRWKRAAVNKVAACIWISALLLAVPTLTVELKLDENGRPCKRAYSSDQQQMGLLLL
ETLVGFLIPFSALSISYVAVSKRIKQMVFRRRNRSVKLIVGIVMAFVICWFPYHTGNIVK
ISSLLAKNSNSELSQKLDKVYRSMKDASGALAFVSSSINPILYAFAAWNFKNGFKVSNLA
KVFQQMNSFKERLEKGMNNSEHRSESITIL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttccaacgcaactgcggatcatacttcggtgccagtacaaaatgcagtggcc
tgcgttgtacttggtttggcatgtcttgttggagtaccaggaaacttcacagtgattgtg
acagttctttgtaacattaagcagcgatcttccaccattgtactcatcttatctctggcc
gtagctgactttgtggtcctggttactttgccgttctggatttactttctcgccgattcg
tggatttttggaatcctgctctggaaactgactgtctacctcatcttcacatccatgtac
gccagcgtcttcttcatcgcgctgctgagtgtggagcgcctggtggctgtgctgtacccg
ttcctgattcagaaacggtggaagagagcagcagtgaataaagtagctgcttgcatttgg
atttcggcgttactcctcgctgttcctactctgacagttgaactcaagttggatgaaaat
ggacggccatgtaaaagagcatattcctctgaccagcaacagatgggtcttcttctgttg
gaaactctggtggggtttctcattccttttagcgcactgtctatctcatacgttgctgtt
tctaaaagaataaagcaaatggtctttcgaagaagaaacaggtcggtgaagctaattgtg
ggcatcgtgatggcatttgtcatttgctggtttccgtatcacacaggaaacattgtcaaa
atttcttcactcctggcaaagaactcaaattcagaactctcacagaaactggacaaagtt
taccggtcgatgaaagatgcatctggggccctggctttcgtcagcagttccattaacccc
atcctttatgcatttgccgcttggaacttcaagaatgggtttaaagtgtcaaatcttgct
aaagtttttcaacaaatgaacagttttaaggagagattggagaaagggatgaataactct
gaacatcggtctgaatcgataactatactttaa

DBGET integrated database retrieval system